Make your own free website on Tripod.com
ࡱ> u   >"!*#$%&'()=A,-./0123456789:?@ABCEFGHIJKLMNOPQRSTUVWXY[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ unknownunknownCTlxFrameState CTlxFrameInfo%:Wd!dCTrellix.MapViewCtrl.2"dGTrellix.MapViewCtrl.2#dATrellix.MapListViewCtrl.2$%dTrellix.PageLayoutsViewCtrl.2TdyTrellix.LexiaViewCtrl.2 :C:\Program Files\Trellix Web\WebDesigns\Drafting Tools.tldCHydraCntrItem  V + www #X HV + R KQ Arial%HomeR KQ ArialV + R KQ Data Object 12  2Z0`}. $m ljContents KData Object 13 2Z0`}. $m ljContents Data Object 15, 2Z0`}. $m ljContentsData Object 16 2Z0`}. $m ljContentsArial Site map forR KQ ArialV + R KQ"ArialxSix Sigma PerformanceR KQ"Arialr 2Z0`}. CDataObjectClient 2Z0`}.V +̙fLeft  3Data Object 1 2Z0`}. $m ljContentsC00000001 C00000002xC00000003C00000004zC00000005U C00000006DI 2Z0`}.CDataObjectRef&F\DORefProxy 60V +̙fTopZZf33& 2Z0`}.V +̙Middle3 2Z0`}.CDataObjectRefF\DORefProxy 59 V + Left)Type text or insert image here (optional)Leftʺ%nlap/&nofg Book Antiquanlap(locgsnfgzisgmswm#oswmFxswm9nofg Book Antiqua4snfgpsklytkl 8pskl*locgsnfgnofg Book Antiquazisgmswm#oswmFxswm:+;,-nofg Book Antiquanlap.locgsnfgzisg<nofg Book Antiqua;;(default);;Left;;;;Presentation TextFul pskl | psklsnfgTitlesnfgpsklytkl scContUnit=====================@Welcome<-scContUnit=====================@to <-scContUnit=====================@ Six Sigma 9%scContUnit=====================@ Performance9%scContUnit=====================@EAbout Us | FAQ | Our Products and Services | Contact Us 484848249&C/29 scContUnit=====================@:;scNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 53 F\DORefProxy 55 V + fTopTopʺMsnfgpsklytkljsnfgklocgsnfgzisgpsbpxlmswm0 r 2Z0`}. CDataObjectClient 2Z0`}.V +̙fLeft  3Data Object 17 " 2Z0`}. $m ljContentsC00000001!C00000002xC00000003C00000004zC00000005.C00000006 * 2Z0`}.CDataObjectRef*F\DORefProxy 99V +̙fTopPZf33* 2Z0`}.V +̙Middle3 2Z0`}. V + ̙fLeft)Type text or insert image here (optional)LeftʺnofgSymbolzisgmswmxoswmxswmlocgsnfgnofgArialzisgmswmoswm?@ABCEFGHIJKLMNOPQRSTUVWXYZ[\]_`abcdgijkmopqrstuvxyz{|}~CDataObjectRef[ FF\ Embedding 1F\Data Object 7 CDORefProxy\ FF\ Embedding 2F\ ndo:Textc FF\ Embedding 3F\Data Object 110V + p/[ CIndexItemC000000071;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;6;ContentsC00000005 1;7;ContentsC00000006 1;8;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.V +̙fLeftC00000001+%C00000002xC00000003$(C00000004z  3 2Z0`}.CDataObjectRef*F\DORefProxy 112V +̙fTopPZf33* 2Z0`}.V +̙Middle3 2Z0`}. V + ̙fTopC00000005');C00000006*C00000007N*YIndex #^ytklmswmoswm(xswmPsnfgzisg psklytklmswmoswm(xswmPsnfgzisg psklytklmswmoswm(xswmPsnfgzisg psklytklmswmoswm(xswmPsnfgzisg mswmoswm(xswmPpsklytkl"snfgzisg psklytklmswmoswm(xswmP&snfgzisg pskl ytklmswmoswm(xswmP(*zisg mswmoswm(xswmP,snfg;;(default);;Title;;Text page;;Ful 1) What is Six Sigma?%2) What level is a Six Sigma process?#3) What will it cost to start a Six$4) What type of savings are typical?&5) What comprises a Six Sigma training%6) What is required for certification7) What happens after training?%8) Will my company achieve the target #9) Who has been successful with SixscContUnit=====================@Answers and Explanations,scContUnit=====================@1) What is Six Sigma?scContUnit=====================@&2) What level is a Six Sigma process? scContUnit=====================@33) What will it cost to start a Six Sigma program?scContUnit=====================@%4) What type of savings are typical?scContUnit=====================@05) What comprises a Six Sigma training program?scContUnit=====================@76) What is required for certification as a Black Belt?scContUnit=====================@  7) What happens after training?scContUnit===================== @ F8) Will my company achieve the target of 3.4 PPM defects (Six Sigma)?"scContUnit===================== @ +9) Who has been successful with Six Sigma?&scContUnit===================== @ (scContUnit===================== @ *(scContUnit===================== @ *(scContUnit=====================@  scNullObject=================== 2Z0`}. V + ̙MiddleType content hereMiddleʺXzisgmswmoswm. 2Z0`}. $m ljContents]C0000000140eC00000002fxC00000003/2hC00000004lzC0000000513nC00000006wG 2Z0`}.CDataObjectRef*F\DORefProxy 99V +̙fTopPZf33* 2Z0`}.V +̙Middle3 2Z0`}.CDataObjectRefF\DORefProxy 104 V + ̙fLeft)Type text or insert image here (optional)Leftʺ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscContUnit=====================cscC 2Z0`}. V + ̙Middle ­ Type content hereMiddleʺ'snfgzisgmswmoswm` CDataObjectClientr 2Z0`}. CDataObjectClient 2Z0`}.V +̙fLeft  3 2Z0`}.CDataObjectRef*F\DORefProxy 101V +̙fTopPZf33*Data Object 23B 2Z0`}. $m ljContents^C00000001HD9C00000002xC00000003CFC00000004zC00000005EGC00000006    ? !"#7&()*,./012345689:;<=>@ABCDEFGHIJMOPQRSLVXYZ\^_`abcdefgijklmnopqrstuvwxyz{|}~ 2Z0`}.V +̙Middle3 2Z0`}.CDataObjectRefF\DORefProxy 96 V + ̙fLeft)Type text or insert image here (optional)Leftʺpsklpsklytkl;;(default);;Title;;Text page;;FulscContUnit=====================cescContUnit=====================c scNullObject===================   CDataObject Executive and Champion T rainingscContUnit=====================@!scContUnit=====================@This training module is offered in recognition that your management group as the Six Sigma program leaders and supporters need to be able to understand the methodology and terminology of the Six Sigma practitioners. scContUnit=====================scContUnit===================== This two and one half day session will prepare your management group to assist and support the business culture change that introducing Six Sigma will create. scContUnit=====================scContUnit=====================During the time terminology will be explained, practical use of the tools and assistance in candidate and project selection will occur . scContUnit===================== scContUnit===================== "The topics covered will include: scContUnit===================== scContUnit===================== !Roles of Champions in Six Sigma scContUnit===================== 4Selection and Roles of Black Belts and Green Belts scContUnit=====================  %Strategies for Six Sigma Deployment scContUnit===================== $Roles of Consultants for Six Sigma scContUnit=====================Overview of Project Selection scContUnit=====================Overview of Six Sigma T ools scContUnit=====================scContUnit=====================!scContUnit=====================@!scContUnit=====================@!scContUnit=====================@!scContUnit=====================@!scContUnit=====================@!scContUnit=====================@!scContUnit=====================@ !scNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 93F\DORefProxy 95 V + ̙MiddleType content hereMiddleʺ "zisgmswmoswm?@JABCDEFGHIKPM^NOQRS\TUVWXYZ[]f_u`abcdeghijkqlmnoprxstvwyz{|}~the Six Sigma tools for a wider variety of employees. Green Belt training is designed to give candidates a learning experience through four "learn/apply" cycles. Green Belts are typically supported and mentored by the Black Belt group and in turn will be a valuable resource for the Black Belts on future projects. Project selection for Green Belts is based on Green Belt candidates maintain their regular positions within the company . scContUnit=====================c scContUnit===================== c The program consists of four training modules over a twelve week period. Each module is separated by a period of two weeks of application on their specific project. In a similar fashion as the Black Belt program, the four modules are comprised of Measure, Analyze, Improve and Control. The initial step to the program is the Define Project step which is covered in the Executive and Champion training program , as well as in the Measure module. scContUnit===================== c scContUnit===================== c uEach module starts with a presentation by the Green Belt candidate of what has occurred to that point in the project. A list of deliverables is provided to each candidate and Champion. At the end of the twelve week training program the Green Belt is required to present a report and demonstrate that they have successfully completed a project using the Six Sigma program. scContUnit===================== c scContUnit===================== c scContUnit=====================c W eek One Measure Module scContUnit=====================cscContUnit=====================c1) Introduction scContUnit=====================c2) Success Strategy scContUnit=====================c3) Defect Analysis scContUnit=====================c14) Gage Repeatability & Reproducibility Studies scContUnit=====================c5) Basic Statistics scContUnit=====================c 6) Process Capability Analysis scContUnit=====================c8) Process Flow Diagraming scContUnit=====================c9) Input / Output Study scContUnit=====================c/10) F ailure Modes and Effects Analysis (FMEA) scContUnit=====================cscContUnit=====================cW eek T wo Analyze Module scContUnit=====================cscContUnit=====================c"1) Distribution Characterization scContUnit=====================c2) Data Demographics scContUnit=====================c3) Multi-V ari Analysis scContUnit=====================c @4) Statistical Comparison of Means / V ariances and Proportions scContUnit===================== c!15) Introduction to Analysis of V ariance (ANOVA) scContUnit=====================!c" 6) Correlation and Regression scContUnit====================="c#!!scContUnit=====================#c$""W eek Three Improve Module scContUnit=====================$c%##scContUnit=====================%c&$$.1) Introduction to 2K Full F actorial Designs scContUnit=====================&c'%%2) Class Exercise Catapult scContUnit====================='c(&&3) General F actorial scContUnit=====================(c)'' 4) Fractional F actorial Design scContUnit=====================)c*((5) DOE - Preparation scContUnit=====================*c+))scContUnit=====================+c,**W eek Four Control Module scContUnit=====================,c-++scContUnit=====================-c.,,1) Mistake Proofing scContUnit=====================.c/-- 2) Statistical Process Control scContUnit=====================/c0..3) Control Plans scContUnit=====================0c1//scContUnit=====================1c200scContUnit=====================2c311.$scContUnit=====================3c422scContUnit=====================4c533scContUnit=====================5c644scContUnit=====================6c755scContUnit=====================7c66scNullObject=================== 2Z0`}. V + ̙MiddleType content hereMiddleʺzisgmswmoswm>}?@zAA}BE{FI{JI}JL}LQ}RU}UY}Y[}\^^b~be}ei~im~mqquuyy~~  ""!!#$%&%%##"")*+,"##$@@@ @ddjjrrstvw{{}}mm@@@@@ ! NETSCAPE2.0! ,C2N++0 M <M$1<<80E<<*NBL  KǍN <L Eڊ1< ENPY/ @ C}23C+2|iD*bPt=YZldHCP*"O* $Tv ,X?80p( Ҕ #T -(8$T@ S(R Eq@2 5I;wVCC P(@6BN-xr_X&!AM\tɤ(y u` 4ACZ"!?K*Xф׼A/*d 7&ЍGzAL(!& (E,z ,cABnQ  ̧tS5x1Q HWgof dX8PE*4u@ `@!-B8d8Z&BBUu'5C$w=($P_dJ f#L@@d"MXA0vg"KA#1!(p[Hz8Z 6g$p ާ0^\:! ,"*0%*L<<'1$0.I<TCI+,(L 8U8K<UEI%,,.12 HN΂$<3 ͅ .RP(+0(,r E 2Hh *"DH;(+` 'FxpppHFM#&2ȒD Vf!h$TȤ"8 YQ9 H QCrH ֌X%SA)Th 0%|4@x*'!A$JJbBNpB>HIb81;B,0xs T0t$BC*&|b]H,HI2 (A %I 9dPXaP!2VH ^=] AoP@L5C%҄ CE%pG TRY$UDp  4v#(@>8P7Ct`Y a(&10QkS:Bh! ʀRAfBg)@_RPC7% YB$՗0zJpE_.`|E C=mD0m rBn i  *0! ,,+-M@K0Q; 7JT @' ;N,,<9UT EJ&H9<2 JNU92FK/% .J­J/+C-($Bb@% $68,$@(eEpkQ 8(XCd@e* <A t2$RQ14@2XGIS(bh'ɰ+ J,*A#B\Z#W%5 ĉH0ӯ;4ZaI+T r!|2 @ Bq!ZK*`l48x%T۬!BLLiGZؘ AM!B# L S1Ij( 긢D`C,`dЗ(6bBCPH ܐ@ @X  hH dJ`DPpX`' VnP%ЅLP' 9Ҋ (W=8hJ+<#P `@+BV9(` 9Ct `0 pÊ@X@1! ,$.1*+*0 =1&=?$U3 HL::'%22 LSP++NH .ƌ06 DI-яT G2 ڏLQ!L H\P G DȂD/"ރH 9QlJH SBà 3$$8pdş`PE  P$)) ? A 6p -p2hBIH#U<DBFb0BA,01 ]D a@H  CxKB|D" @Є &B‘d*a!-8 dC @. 7J @^ FP@%i9J 5rA@GEЋ@`FI LD9(18 {8E$N DL .8AJ$QVD @E H  $X$)IV =KJO (ac'0 pC`#6 ! ,Ref F\DORefProxy 93 V + Text Lean Manufacturing ModuleMiddle f!Six Sigma Lean Manufacturing is aLefteCDataObjectRef\ FF\ Embedding 1F\Data Object 22 CDORefProxy] FF\ Embedding 2F\ ndo:Text    y "$&'()*+,./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghjklmopqrtuvwxz{|}~d FF\ Embedding 3F\Data Object 144h FF\ Embedding 3F\Data Object 110V + s<\F\Data Object 156V + p@8[ect 153V + p p5[ CIndexItemC000000071;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;6;ContentsC00000005 1;7;ContentsC00000006 1;8;ContentsC00000001 1;ContentsContents ContentsCDataObjectClient  V +``B/ QC:\Program Files\Trellix Web\Images\Graphics\Business-Professional\cell phone.gifData Object 102 gvl 2Z0`}.f,mf,mContentsuC00000001ikC00000002xr 2Z0`}. CDataObjectClient 2Z0`}.V +Leftdd  2Z0`}.CDataObjectRef F\DORefProxy 52V +̙fTopRR3 2Z0`}.V +RightdC00000003jpC00000004yC00000005mo!zC00000006#zd  2Z0`}.V +Bottom 2Z0`}.?V +Middle 2Z0`}. V + R KQ8 MS Sans SerifLeftLeftʺ dnilpsklC00000007nr%C00000008-C00000009qsi"C0000000Atn$ytklibllimnlibrlnlappsbp@ psklytklnlappsbp@FulscContUnit=====================cscNullObject=================== 2Z0`}.CDataObjectRef$F\DORefProxy 48%F\DORefProxy 49&F\DORefProxy 50'F\DORefProxy 51 V + ̙fTopType text hereTopʺ locgsnfgzisgibll@ mswm#oswmFxswmpsbp(dnipmnlpsnfgzisgpsbpPibll@ mswm#oswmFxswmpsbpPdnipmnlp locgpsklytklibll@ mswm#oswmFxswmdnipmnlppskllocgpsklytklibll@ dnipmnlpmswm#oswmFxswmpsklytklsnfgpsbpPpskl ytklpskl ytklpskl ytklpskl ytkllocgsnfgpsbpPpsklytklsnfgzisgpsbpP locgzisgpskl ytklibll@ mswmoswm2xswmddnipmnlplocgzisgpskl ytklibll@ psbp(dnipmnlpmswmoswm2xswmd;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;; $%&'Ful      Title locgsnfgzisgpskl ytklibll@ psbp(dnipmnlpTitle locgsnfgzisgpsklytklibll@ psbpPdnipmnlpcContUnit=====================cLTitle of Home Page | home    !/019:ABIJcContUnit=====================cTitle of Current Page scContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifRightRightʺFulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺFulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQDB MS Sans SerifMiddleMiddleʺdnilibllimnlibrlpsbpFulscContUnit=====================cC0000000BstIndex Data Object 103 z 2Z0`}.f,mf,mContents scNullObject===================    V + Container PageMiddledCDataObjectClient­ CDORefProxy0 FF\ Embedding 3F\Data Object 1111 FF\ Embedding 3F\Data Object 1122 FF\ Embedding 3F\Data Object 1133 FF\ Embedding 3F\Data Object 1144 FF\ Embedding 3F\Data Object 110V + `!P  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&V +̙fLeft  3C00000001wyC00000002xC00000003x~C00000004Ű 2Z0`}.&CDataObjectRef&F\DORefProxy 88V +̙fTopZZf33& 2Z0`}.CDataObjectRefF\DORefProxy 85V +Rightll ̙f3C00000005{} C00000006zC00000007|]C00000008I 2Z0`}.CDataObjectRefF\DORefProxy 86V +Bottom$$̙f3 2Z0`}.&V +Middle3 2Z0`}.CDataObjectRef F\DORefProxy 69F\DORefProxy 70F\DORefProxy 71F\DORefProxy 72 V + ̙fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺ>locg3psklytkl@psklytklBpsklytklNpsklytklOpsklytklPpsklytklQpsklytklXpsklytklY<nlappsbp Dlocg;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;; FulcContUnit=====================c    Q>P@ OBN<scContUnit=====================cscNullObject=================== 2Z0`}. V + ̙fTopTopʺ9psbp locg3locg3locgf3locgfzisg mswmoswm(xswmPnlappsbpxylocgsnfgzisg mswmoswm(xswmPpsbpxz locgsnfgzisg psklytklmswmoswm(xswmPpsbpxe locgsnfgzisghpsklytklmswm-oswmZxswmnlappsbpxpsklsnfgpsklytkl locgsnfgzisghpsklytklnlappsbpxmswm-oswmZxswmpsklytklTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgzisghpsklytklnlappsbpxcContUnit=====================c!Title of Home Page | homeyzscContUnit=====================#scNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================C00000009yC0000000AC0000000BIndex  2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulcContUnit=====================cscContUnit=====================cscNullObject=================== 2Z0`}. V + R      !"#$%q(*+,./0234689:;<=>@ABCDEFGHIJKLMNOPQRSUVWXY[\]^_`bcdefghijklmnoprstuvxyz{|}~KQDB MS Sans SerifMiddleType content hereMiddleʺpsbp psbp psbp psbp  locgsnfgnofgArialzisgpsklytklmswm#oswmFxswmpsbp locglocgsnfgnofgArialzisgpsklytklpsbp mswm#oswmFxswmpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlelocgsnfgnofgArialzisgpsklytklpsbp cContUnit=====================cT itle of Current PageԲscContUnit=====================cscNullObject===================    V + Text - Arrow NavigationMiddledCDataObjectClient CDORefProxyE FF\ Embedding 3F\Data Object 105F FF\ Embedding 3F\Data Object 106G FF\ Embedding 3F\Data Object 107H FF\ Embedding 3F\Data Object 108U FF\ Embedding 3F\Data Object 109V FF\ Embedding 3F\Data Object 109X FF\ Embedding 3F\Data Object 110V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&V +̙fLeftData Object 104 h  2Z0`}.f,mf,mContentswC00000001&C00000002'x  3 2Z0`}.&CDataObjectRef&F\DORefProxy 88V +̙fTopZZf33& 2Z0`}.CDataObjectRefF\DORefProxy 85V +Rightll ̙f3C00000003)C00000004-C000000051C000000065z 2Z0`}.CDataObjectRefF\DORefProxy 86V +Bottom$$̙f3 2Z0`}.&V +Middle3 2Z0`}. V + ̙fR C000000077C00000008?9C00000009TyC0000000AZKQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + ̙fTopTopʺ locgsnfgzisgpsklytklmswmlocg3psklytkl@psklytklBpsklytklNpsklytklOpsklytklPpsklytklQpsklytklXpsklytklY<nlappsbp Dlocg;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;; FulcContUnit=====================c    Q>P@ OBN<scContUnit=====================cscNullObject=================== 2Z0`}. V + ̙fTopTopʺ9psbp locg3locg3locgf3locgfzisg mswmoswm(xswmPnlappsbpxnlappsbpxylocgsnfgzisg mswmoswm(xswmPpsbpx ­ z locgsnfgzisg psklytklmswmoswm(xswmPpsbpxpsklytklzisg mswmoswm(xswmPzisg psklytklmswmoswm(xswmPsnfgsnfgzisg psklytklmswmoswm(xswmPpsklytkllocgsnfgzisghpsklytklnlappsbpxmswm-oswmZxswm psklytklTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgzisghpsklytklnlappsbpxTitlesnfgzisg psklytklcContUnit=====================c!Title of Home Page | homeyzcContUnit=====================cback to Title of Up LevelscContUnit=====================#scNullObject===================C00000009yC0000000AC0000000BIndex  2Z0`}. V + R KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulcContUnit=====================cscContUnit=====================cscNullObject=================== 2Z0`}. V + MiddleType content hereMiddleʺpsbp psbp psbp psbp psbp locgsnfgnofgArialzisgpsklytklpsbp mswm#oswmFxswmpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V +       !#$%'()+-./012345679:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefhijklnopqstuvwxyz{|}~Detail - Arrow NavigationMiddledCDataObjectClient CDORefProxyE FF\ Embedding 3F\Data Object 105F FF\ Embedding 3F\Data Object 106G FF\ Embedding 3F\Data Object 107H FF\ Embedding 3F\Data Object 108U FF\ Embedding 3F\Data Object 109V FF\ Embedding 3F\Data Object 109X FF\ Embedding 3F\Data Object 110V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&V +̙fLeft  3 2Z0`}.&CDataObjectRef&F\DORefProxy 88V +̙fData Object 106  2Z0`}.f,mf,mContents­C00000001C00000002xC00000003C00000004"C00000005&C00000006*zTopZZf33& 2Z0`}.CDataObjectRefF\DORefProxy 85V +Rightll ̙f3 2Z0`}.CDataObjectRefF\DORefProxy 86V +Bottom$$̙f3 2Z0`}.&V +Middle3 2Z0`}. V + ̙fLeft)Type text or insert image here (optional)LeftʺlocgpsbpxsnfgnofgArialzisgC00000007,C000000088 C00000009gQC0000000Am* psklytkl mswmoswm(xswmPsnfgnofgArialzisg psklmswmoswm(xswmPlocgsnfgpsbpx;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + ̙fTopTopʺ9psbp locg3locg3nofgLucida Handwritinglocgf3nofgLucida Handwritinglocgfzisg mswmoswm(xswmPnlappsbpxlocgsnfgnofgArialzisg psklytklpsbpxlocgsnfgpsbpxpsklytkl locgsnfgnofgLucida Handwritingzisghpsklytklmswm-oswmZxswmnlappsbpxpskllocgpsbpxpskl ytkl snfgnofgArialzisg pskl ytkl snfgnofgArialzisg pskl Title - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgnofgLucida Handwritingzisghpsklytklnlappsbpx  pskl  | locgsnfgnofgArialzisg pskl snfgTitlelocgsnfgnofgArialzisg pskl ytkl cContUnit=====================cTitle of Home Page cContUnit=====================c home First Title of This Page's Sequence | Second Title of This Page's Sequence | Third Title of This Page's Sequence  18\c  #1 8 $\ c #scContUnit=====================cscNullObject=================== 2Z0`}. V + Right)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + BottomBottomʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + MiddleType content hereMiddleʺpsbp psbp psbp psbp psbp C0000000BrIndex Data Object 107  2Z0`}.f,mf,mContents ­ locgsnfgnofgArialzisgpsklytklmswm#oswmFxswmpsbp locglocgsnfgnofgArialzisgpsklytklpsbp mswm#oswmFxswmpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlelocgsnfgnofgArialzisgpsklytklpsbp cContUnit=====================cT itle of Current PageԲscContUnit=====================cscNullObject===================    V +  TextMiddledCDataObjectClient CDORefProxyU FF\ Embedding 3F\Data Object 109V FF\ Embedding 3F\Data Object 109X FF\ Embedding 3F\Data Object 110V + c  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&V +̙fLeft  3 2Z0`}.&CDataObjectRef&F\DORefProxy 88V +̙fC00000001C00000002xC00000003C00000004TopZZf33& 2Z0`}.CDataObjectRefF\DORefProxy 85V +Rightll ̙f3 2Z0`}.CDataObjectRefF\DORefProxy 86V +C00000005C00000006zC00000007C00000008 Bottom$$̙f3 2Z0`}.&V +Middle3 2Z0`}. V + ̙fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺ>locg3psklytklQpsklytklXpsklytklYZpsklytklDlocg;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + ̙fTopTopʺ9psbp locg3locg3locgf3Vlocgfzisg mswmoswm(xswmPnlappsbpxblnlappsbpxmrnlappsbpxvnlappsbpxnlappsbpxnlappsbpxnlappsbpxnlappsbpx\snfgzisg mswmoswm(xswmPpsbpx]locgtlocgylocg^snfgzisg psklytklmswmoswm(xswmPpsbpx_locg`psklytklaulocgzlocgdlocgsnfgzisghpsklytklnlappsbpxemswm-oswmZxswmpsklytklpsklytklpsklytklpsklytklsnfgpsklytkl Title - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgzisghpsklytklnlappsbpxcContUnit=====================c!Title of Home Page | homeeyzscContUnit=====================#scNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R C00000009yC0000000AC0000000BIndex KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulcContUnit=====================cscContUnit=====================cscNullObject=================== 2Z0`}. V + MiddleType content hereMiddleʺ      !"#$%&)+,-/0134579:;<=>?@ABCDEFGHIJKLMNOPQRSTUVXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~psbp psbp psbp psbp psbp  locgsnfgnofgArialzisgpsklytklmswm#oswmFxswmpsbp locglocgsnfgnofgArialzisgpsklytklpsbp mswm#oswmFxswmpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlelocgsnfgnofgArialzisgpsklytklpsbp cContUnit=====================cT itle of Current PageԲscContUnit=====================cscNullObject===================    V + Text - No NavigationMiddledCDataObjectClient CDORefProxyU FF\ Embedding 3F\Data Object 109V FF\ Embedding 3F\Data Object 109X FF\ Embedding 3F\Data Object 110V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClientData Object 108  2Z0`}.f,mf,mContentsC00000001'C00000002(x 2Z0`}.&V +̙fLeft  3 2Z0`}.&CDataObjectRef&F\DORefProxy 88V +̙fTopZZf33& 2Z0`}.CDataObjectRefF\DORefProxy 85V +C00000003*C00000004.C000000052C000000066zRightll ̙f3 2Z0`}.CDataObjectRefF\DORefProxy 86V +Bottom$$̙f3 2Z0`}.&V +Middle3C000000078C00000008W6 C00000009yC0000000A 2Z0`}. V + ̙fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺ^snfgzisg psklytklmswmoswm(xswmP_`zisg mswmoswm(xswmPapsklytkl bsnfgcsnfgpsklytkl dsnfgpsklytkl epsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful pskl psklsnfgTitlesnfgpsklytkl cContUnit=====================c$First Title of This Page's Sequenceda##cContUnit=====================#%Second Title of This Page's Sequencecb$cContUnit=====================#$Third Title of This Page's Sequenceda##cContUnit=====================#^_scContUnit=====================c`_scNullObject=================== 2Z0`}. V + ̙fTopTopʺ9psbp locg3locg3locgf3locgfzisg mswmoswm(xswmPnlappsbpxnlappsbpxnlappsbpxylocgsnfgzisg mswmoswm(xswmPpsbpxz locgsnfgzisg psklytklmswmoswm(xswmPpsbpxpsklytklzisg mswmoswm(xswmPsnfgzisg psklytklmswmoswm(xswmPpsklytklpsklytkllocgsnfgzisghpsklytklnlappsbpxmswm-oswmZxswm psklytklpsklytklTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgzisghpsklytklnlappsbpxTitlesnfgzisg psklytklcContUnit=====================c!Title of Home Page | homeyzcContUnit=====================cback to Title of Up LevelscContUnit=====================#scNullObject===================  2Z0`}. V + R KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulcContUnit=====================cscContUnit=====================cscNullObject=================== 2Z0`}. V + MiddleType content hereMiddleʺ;;(default);;Left;;;;C0000000BIndex Data Object 109 Δ 2Z0`}.f,m5mContents ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V + Detail - Title NavigationMiddledCDataObjectClient CDORefProxyU FF\ Embedding 3F\Data Object 109V FF\ Embedding 3F\Data Object 109X FF\ Embedding 3F\Data Object 110V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&V +̙fLeft  3C00000001­C00000002xC00000003C00000004Ű 2Z0`}.&CDataObjectRef&F\DORefProxy 88V +̙fTopZZf33& 2Z0`}.CDataObjectRefF\DORefProxy 85V +Rightll ̙f3C00000005C00000006zC00000007!C00000008m 2Z0`}.CDataObjectRefF\DORefProxy 86V +Bottom$$̙f3 2Z0`}.&V +Middle3 2Z0`}.CDataObjectRefF\DORefProxy 89F\DORefProxy 90F\DORefProxy 91F\DORefProxy 92 V + ̙fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺlocg3psklytklnlaplocg3psklytkl psklytkllocg3locg3psklytkllocg3pskl ytkl locg3pskl ytkl nlap;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;  Ful  cContUnit=====================c      scContUnit=====================#scNullObject=================== 2Z0`}. V + ̙fTopTopʺ locgsnfgzisgpsklytklmswm?@BCEGHIJKLMNOPQRSTVXYZ[\]^_`abcdegijklmnopqrstuvxz{|}~;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V +  PresentationMiddledCDataObjectClient CDORefProxyU FF\ Embedding 3F\Data Object 109V FF\ Embedding 3F\Data Object 109X FF\ Embedding 3F\Data Object 110Y FF\ Embedding 3F\Data Object 105Z FF\ Embedding 3F\Data Object 106[ FF\ Embedding 3F\Data Object 107\ FF\ Embedding 3F\Data Object 108V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents ContentsCDataObjectClientfghijklmV + -Text V +``V +`` &%WJC:\Program Files\Trellix Web\Images\Graphics\Photographs\sky at sunset.jpgytrsjC2n(HC:\Program Files\Trellix Web\Images\Animations\Objects\moleculegreen.gifEmbedding 3f!b 2Z0`}.5mMljContents(Data Object 63` 2Z0`}.5m5mContents+­Image1WImage14(gempubImage1)" WJFIF4Photoshop 3.08BIM8BIM8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIMAdobedۄ            %&"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw# ?mtDksF*b7F} nVXZBadGRȩ7e,;E=%4P6R) a6?:) ؋F* 2[cPN,!7{1­^~kZTܦHRޡq2ן=Usk =*EiHD(ȷۖ{81PFԅUX['Bu/k!b6Otw{*~4VG;YK)<iʛ\rtM6[é䵞X8:@쫺md5S հǓ6߹QL5#ABۢҤ2;vQ"B#iKԤ.(`ˏ -{B^H&UݹFG&pv `U^:# B8<&YBp*L 9H$ó]ò[Q=2>iq# G< ˝UMqq7Aa W0{=-N,!­vչHmXϬh`LZG qe7P&ghJkC ٞQC ȉHϊu­/PC]Geduc4:(u):W#1*XaOuPNz!Jpl'C=\X #vӍr ]c[­ǂ@\s˴q{+xU ~:dny={ >햾J/;nGbey8FoRk<gN4T.+El:JewkL=e; x2I@`;'vݥx b׺ClU4~CB1=GW6 >3ѢN;h]9L'u:"8R T4S&I8]M)"Ю:3C ]f>7V;G,[ьGoC~z=}x軱_5G܈vxz]#Q"!vcHc&Cjm|ߺW4^if죲.6thk"<wcZeB7RZ_0ho0> x@3OyOGu  \ ۴H7BrSUi)JJmx ȍ$Ju1^'E`*PBwkkuX8("9WXln0­*n{#@bFvt,&cT@֎Ш3i*l­CWKt=H>N j @̒uJ =HOm~1S bg'QI)Lh ۘx)n'D۔%<g:$:$+­ h.qbz;:ݒ$UN1%Id­f h-@7 wތǵDQfXh­wU(O%0ږ4Z8%1d Ix^ 4SL&CuuglѫZ> )13;Yjz6cL/GߝW;>{OC̲">*;3]ϢߟOq^t%E2un% pa|p?_"Z`) ܆܌vvI4m\S):Ic%^ԯE­TTvz!9s2?޵(­?> RkN2Q(oYlkxQ1X%rAFX X`!pvW.:ȯXnBz ^ԝX): ck?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy~|}qO=Ч:r)ARHNשWN)ן"6ҫ)$ظO:y "w "R1 .γi3J{Ӵ=t'x­"HCVw'KG)$NÄH L=D5CܟuPHJ ɿ(gܝ;6;tJF c`X)A  !XgpZG-HP91#$<ƪ&kdB­ve6N$z+5e<H8dOTnVm7)wdxU=]g0jުee]LZP0 Yۀk[L<*YDil & vjZpiE^$­*!4Dm9NtC,;2_tC VV)@{Weٙg;2:*a'pOIl2 z7hwU !Q4wYǔaiJ>sc+iiQN&sOiZ9)Rx/9m4p@~cG$*{:?&Xth RQAUwWcɁ)仳 Ptx*fcX3ʢ.:R˽77^!K.{$rʷ ]X ­`wM֑c=t)cޔeƏ`}_aD+`Kk%I'$hUߎp fÁ $n*l|ĥO @5‰oeeU AnCO z4v'X5P,IߚGD!0i'A%=Qac0WwTڑЖ++'?48?)0q:)~ =whRIOnAJYvucvbS$g̰e '!N$!^5x;]xw˒5:En"~IT`z71J hӺΥH_wepëcY{#DJ@)^#V!_~Sa G)a4WyI$n 2r) yH:2D)c:a3ٴl­uw`+2c۔NJD6^jցm'1 ĈS5dlcHE4hZ"7d<]'\;o)O>M:'Cd◶tEt0IQINw3|TID@`R4weX7^STXn2n`k樾i  }@ɞCyTy=ԑ,3 Z;OXd H(FޤOa" nBpZV#/cRJR$LSO)L Ҽ E IF|EkLowU--"g<  oJmd ^5KwiC\IO4C@ܗ%Il Y-RtC.'nYTf.S9Yl]ۢii5*­'s*?TDY7[ Pbx NnQ6<RgY =@P6\7 -9@؂^]u"4 H Z@=ȩ5'kR  i O'@N$ԃTTBTSȍp]L:\"KU'K­$,U[ҥ[kФiEmi uU<,DF{x#Sma(owܔBY;HH^~E1tiV̼("RQ?؍"җ((~*%ȀR( ]ԴnzUTe:lILJBҹ)Oi U*$bAT[&RT5M=(g)vCN ­&Â%k$}"9[nSU=­# N{X6ðm~IZ8(Lh6Ы{4|T­- (bd!U?A= /CSB(`r4QAM7$qU}l/%MUdf-&j%{P=iZGtۘe"Xb|I\q`ڂ{" XҚrkVoܥ.mr d7[kkn*gѲ+3An<w56dVZLI6xyL I-qn ͹ О<>­2B#t*;Zaڰv<qq$uLKw@'K"U%7b;Otw8[6jI=ʺ{d0}{9Jn@Ih>>K>I@a-i7iJq!}e$$R6D 3 lȪ {\U^O[7dCwlo ꥗P<GTØ6=7 :[SWgQC;CjHY?XZvhԸD<#z &W8>Xc 7Th3gFغީ_Tİ I(­ˡc] މMiĪ­8 BиK% fԇ.OTXю|bgu+,'q vGviyEZ̵UhmDKLY!`. 1G~7hl8 x5'BVW][lqh>#X\+m3'Ry_ َ ѮSu@2a#|DnRq@R"7=˗YNhCҺϪ 6x Ɔ:Wjm wiJՎ 'CQ,haּhAV-kine DUwYk5ֆa2XN_`ɥ1HS1pG*̳p@ |mi2X+cipFA{CDQos\iK 3m/ฝTo/t·pK~dj c@<T1J~ߒIRqװi徧n'D #;# 9rS'l#tX)ޟ7z­A­:Ӻn1ƳL,2$)s\HʂpvS#@AL+m{Li$oWkfXCT.Ͼ7#B|UT*,KD[k@S$Jp5'~In<B}sJt($,'4E P6OY xη y)*}'i>%LD*";d՝([5+ eaIQJ@0 $k3paZБ&RHh­U;B @$edkrU}­*H+ȧObQ.LL@c% rCcuKq -BnP{#P0%)L(Wt2I!IJIH'IJI(I%,PJRI'EK$$p|R$8JRpR O|B8L PK))&CV)LPȡa<o)ެ>E g%̾R>nȩ]DuCC%R.}H'E?)Fo|r\A<i.cʫw$~>O/KwW<K._ܗʘ]2<qG%Ӯ}I<U=)ԫ~˳$vY_]2O˳Se1L>-K+]u%яNm0֏?4%SfQ1?Ie)QqrydL况N;ڛgs~MG+ۓ̀etcsO.睟ϩl3.>gc'*φm2l ­RO~dqBOİOmϰ&x?ap-YZmໜ/aӻy5_o2so5#HnhH>JU݂aИA܋phx變Cj $a36 @:(O34}u솟Ԇ0>`/ sQqqtk;de[ zD@dDn)}?S0mo"v;[(z x+s9B[ΰCdVg&J9п_ӏ0I.0j^i+SdGg*cGo.G x½RXgNЂx.&x=J}WN٣J 9ik8.K}?T;N­>/~Kκ}鬶1wX8L[gj6f?FZ[>i)(;Kݨ3͇w >uJH7' Ɉ= N F$Ɉ׺xH"' _:obLI$ w=i jX1>ZJ7>8s@:rw IZ80AsΞ#q_SPF`i2)%ۮ`8N-pIJvGS0 u'ʎʁYQ.sx͍Iqt2% Gԑl%i- 'e k 6yOK9=%H @t t`})]9LɃ (*0 v3ʘv9qP,Θ)6w<ۏI͆tH9'@59e/N+^'YM2iE: j 6{j\`w/ HyM.@G2uO"jtڵ­x|F3 Mgo$fQnӗ7V og8M|mNI~% $RU>UT֟th*\vˣ(e[$!֚<ÃZGsrȹփ=73woi"?uo;B'Ce퍇i1MC ۈLGy懺`~h:|T[%7#4=~ ­kFSL= '`^0<Ʃ:"L8$2}"OcjxS9q#M"Sw8vNZ΁<W5$$Z0gNI4F֍^|JJ`&^9,w4ߘkgA TZlvu9Cqɡ>>ZOgv}(6C HsFu1t ;0=@_g\ZikK{s Z6hSpi Owܘt.?x˿_c4swJ-:P@5q*M])­'N2 7S4*`OM ZÇG$9+<Tw=@5?I qhE+Ck@|RShkIpS{%u#)m/C?5 {{%D:CLq8ƲXg!Pm&aIl-:蒘mpMqԙb>qRhs7t Ovl9­5%,]43‘du*F CeO?maձ1)McK*_BfHx>*v O$~kK6-qrѝ.i<:@'VCuҽ :_7 )a~$?V^Z+nC{jB(d60oe cOy $H S\ +87`su6w]鼉eo:{ u$R${sqqd7#5bcXߴ>@ӨhƚƲ\[ӻ4+voYS1͝H?Ev]u(:mD@ {xpL26xC^N$F0#7d8fIIŲKÀ]> JoaBbOquYU@6$?l{Umn>^v#R<LJ$@ɌRXu۫?CQ-~[VlsIkΆYwP]X­cbm ;k!8'R42\|5†k%L~SĬYTk\Hl }*   ڍ1uL$[s\?FH={*i^Zj G Bk"]X'Ivn`{[˄J{lio @Ղ܍w;\h/q.V Nu@UKI $w3*ck+pGB^U- j%,Ө' {۶#w ͮhaZ~H)!k6$PD{s<%Un:@ qs\H>Z6E5g)lK$w(0ÿ/bntZld4#Qx{ GH9pKsHճ^5II36ٓHsAs`)sv״8 ~$ {4?Cv ֤#Oqw7^cB~JE^" R(`6­|GBcA­k7${^h|5'n<0#AS,]R\  ]}))P%CGAY{eഇ!_[@ A?Ro FcII[L4dv:cII_ xt:N+ fI p< IHm;1:y"퓯?u&#R5_ K< %6H}`#jq"]sfLRk2i/Ex'5L_}2@5wltoȍΑ(57[urv4Fv'B}mDk۝[+$?IIInYз|9m 4N=xbNukμi.qmd?PJ{Xt8ƗMtON=Ɓ\_IFvk1w[l8{|'.nH;&i!y9ֹJFE{ BkduGnMkaCZxH;))!Z%9ҁC_4ԖXes'nDs1hulyi#qIJ;!6tN-XZa 0g{wY]­ kuq 9%2h5p@' xڊ3}@^84BD;6%&m˴%"goAsZGB,!ν1.?c-$v?RJ} ]4C+iZti\׾k`F\{k7­- =.r _yAkÌK? f"Z'wDŽ=]eqqݨŬ 8@­CWminym׍'yIVVj5ŬWd. {OX ;_ #­g-yƙqiIj-/ulpY8n>|\w]M K\h ­"Cl㹲׋\v:]CXg5̞;5-0GNgG2=Cv$k^{9vڈV-R^Ɖk}t*h,xN ;Wۍ PgI  ȽL]; G-kNk@

P}װ/nl#j|z| T[lI.$|"Î&HL \9ew}XᯑӁ[/;!mp󻇸ꀦib<Kf7iRhkaԂD椦/npq}LQ\­xORL%% _9?|I~r+Hxi'M!~ IƦ5.J`CIF\x{hƑSk­ˉϷ;DiׇZ;rԔC ghlONw5]Y'B$Iԟk)Ts''! XZ,70 Eme94D~YzE:w{Z\7K`ڍ̍ grHevC:SkK&IJyq#yhAlL5aK,?u5OaŕZݧmnɬ޵>Cg(k@#́R%t{C~{T͎6oQ)­­h~4{nL˳Y<5ZdGQ\amucAH?I6k­vSCL­4r#h04m!B5kMG?E7Kj+f睲u5~jY5vɄ ]a;^X,~ib Ak IESke^Uwձ$Y$v#?1A4v?#hvF43'4 5 BD&CAnr LsfL{{Q]QXAvi.]WC mO­;v/­۷-:­ԟojƺv%¾Ofqm c}&߹W\F ia­aΞN,Yh6z`D_n-`$4h$ȅ7a~|9ɢ.~|:-W­uFֆ45 ipm{;i*u7TᨰY w_EudK[K%G@u­G-ɵl;Z} `K*@ I>(nv3eKvj3„iaK}-ޑ7Lc]OL8ڜ ^ZHwU8.Kkd{GLjv5v潶43n6wmUEO!lkRQ '6\=$uJ­qc|qÐ:s${AkUk,mYcK@H!A<v)VIgd[@umq4ݸ%k^=449m_ys"/J-0mc"\mGksp{c_l}-^NiߘA$plY5FSBEm%|r[\NCc­F[ah {Pvݩ٘NLMl͗iiI)N(k}J8eOsC$y0xRnbN<"ٌ kFAm.i%eO$BZ{wxV2"'A~v؏*A찖G­]cFɟ g;=!@m7jz-Ǘ}܏؊CΆX}75Ts=O #> z6s;DP\$s}IWK!?` L8msf 47Jj. 0{@!?$d'h>ԘYcٵol=ɫѴnnb<lp`"΄%6%ݡ0S9 sk ;yxpdE{ul"P+ՖO%.Q/'ipe*;ckqjVoo`rB<֙p?_RQXkAEȕ mߺuquՊn=$w+u l[HK]u$jC7gXI%?Ф워7N#^|Xu[Xqos;*WSlsę2o3­dy@?z=7nQ~'9VfuWXƍ j%8_~Wk_oIV:ڋ! C$T*޵2_de8/rfWMxhk a'/ F+ ԟL ­ƹ5 M3po!­w>+>b,{ϸHob@{G4Ú[Rm5[-Uu,yp{h:-Qig7kUݐ*c]sRO\, C* ia7v1.q'#n=uYK'֝ͯI 7TDCڅ+BVo.^!ᾩ85Z}ج­ϸMo= ?1E*ƞ9H?Qˬ|;]W[ 61:;r`K_c%X;mxippi'OVl,G`#s@ KmN}ێՆR-$DĞ? I!Maݤ羿k)eln]7sm\4i; 2vW$;p. %4S`y2%|ZK,m-} ­SQY|vLYLűVBL|\ 3YURï~%5dPEfc{r5s`1ЇTUx}΀6׏x Mn <rMl F4{=nh&kHH4ՐXZXGMSį"l6zPK}7wcqVD~knW+$;{Tr=7_XUvi lsOy߳oV)/fk984$YS%g_fV-}ti-)cZk5W]teӾՇ]is:4h+Y&ʫ.]:GחZsep:pVֹs^]6v޶A1^Nv5Mu/E,ƾ msCcuֆ7{=ڇ ;-[;]tKwHTwඤt==s-a$MokK~hkR8k*c mk@ O17ܚLcG}}G*tWd9dKYwܐ]8TE6`85/­­+6:6K­Gzz.8MpEWU}@sv؜RMuFJtm­8 #v7UL<\hk}GY_h!nmA]5ю?ijxp i nI TVkGB(uvn9ע5㴲ܴoRیd2+ gU(õ$O(:ꃍc@5G'!Z ldfmEp,kISSW8V4;SR$6ش $yq7@t-AxyeB;4MH=VߤY?;yfƆqKdk{bӘծ8k9cA55pm5Qqd Fדv^? dz~&Mc0&{j̐2|"TX+$nEH&v.^-kCF?w# { H9W ԛch­rpZX:1=8XD8@yCoL{Z@A(w=< 6$^}6y{MuwE LQr*`X%{BgZ-.k]Qk ?9/smS ..c[:j[Rn]m.Ph#b?MZC5:׺xq-iII}`繚iS{ZY: =k­p:{򟤈 @?$, ]dL6[9; m?PX\tPRΦ6=tt9 [fT\ubO`vos6ÉvPNѷd$|Ow%ǧ67+w\w0yeyI>>wzDz[Qǫ9cڼ$;) il?L}wڋ\GWJ;=8v_t櫎{g;^r!mџ­;?Gӝvmؼ$>G;u'j7­>2'v?\:H[O7mgٷJzhnэ}GKz zӶ?%1;wjD\g7H>tܼ$u+GwG{c­IhYmoWVK#c}aH_JO/S}Зm6lsi olԘb?ߡ5&\:>}_GГԎ<?'ӝ+I}G_S]w}8S;7lkDוw\>}o6vV_N=?n?}xbJMbm=oV?"dV1oIޱ݁߻r%ߪ'^_=/UX|zͼԯSBG`蜏n쑺=.?;vv#|nȃ?ھoI4{x.օrPkݶm?XNgM{I|̿?_hv=6nY][976=-b}SZeW۴}8^Vw=}7G$Wo6zvMOfΝ_$-_[fϧi>1I#z?/"Iӿh:l5]*߿yzH }­Sw|5 1y$­]pݑK!A՟lLu)"v}D}_NnSv /]$-?W}ޫۢ8ݞ7l׈W$T=o m+6gl?$۸z?i8=i"T?JdFGOwSٳnXc7m}=n$>Fͯb;o?^@I}oOUlavzo~jDW6K7 KCDataObjectRef FF\ Embedding 3F\Data Object 152V +``~K GIF89aC/.-.212656===@ @AAAFEFIHJMLMONPPOQRQSSRTVUVWVXXWYZY[[Z\\[^]]^_^``_aa`bbadecfedfemfgfhigjihijilmknknmnmngqhhwhmsnnuooxoompqorrpssqtusvutvp{pwuyxvzzyz{y||{|~}~@@\[^\ZWTNZT_Za[c]c]stwwtsvwvvwxxysrvurnrm@@oiohngngoh}~ ­ ! d,B/33*3 3!­2,3(3,.,/(2./+.0Æ0ǐ'/1Ђ*/ԏ1/++/'**ƒ,0.?HF(*+*f0g!=E(i*0K *zB& 8|5 ^d` G#As/* X@KC,IT#AY? X6eGѫM SQ-K= Eθ&K.Z6G)<0OOP@-[ ar s9C-\(.' 7 F[,Ԧ eUI wϓ`E nS=Cp~1mK<`et CDataObjectRef FF\ Embedding 3F\Data Object 63V +``wr?Ȓ? P@Z(}( PIC2d}PC2Le(( Data Object 98` 2Z0`}.5m5mContentsAImage1D"Data Object 105 ` 2Z0`}.5m5mImage1FContentsUrData Object 106 ` 2Z0`}.5m5mImage1Wʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f  ! P 2f9!KÏUV +`` >F:\Arrows\10up.GIFup(|( hPIC2d|PC2Le(( hʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f  ! P _4;FW$V +`` <F:\Arrows\10prev.GIFpreviousContentsfzData Object 107 ` 2Z0`}.5m5mImage1hContentswv(x( hPIC2dxPC2Le(( hʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f  ! P  V?}P7 jMV +`` <F:\Arrows\10next.GIFnext(( PIC2dPC2Le(( ʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffffData Object 108 ` 2Z0`}.5m5mImage1yContentsvData Object 109 ` 2Z0`}.5m5m ­̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f  ! P o j@?^?V +`` >F:\Arrows\10down.GIFdownV +`` DF:\trellix files\work files\Drafting Tools\Drafting Tools ground.jpgV +`` b=F:\trellix files\work files\Drafting Tools\Drafting Tools.jpgImage1$ContentsData Object 110 ` 2Z0`}.5m5mImage1. JFIFHHPhotoshop 3.08BIMHH8BIM x8BIM8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM@@8BIM8BIM p\ TJFIFHH&File written by Adobe Photoshop 5.2Adobedۄ            "?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?I%EI%?I%EI%?8BIM XICC_PROFILE HLinomntrRGB XYZ  1acspMSFTIEC sRGB-HP cprtP3desclwtptbkptrXYZgXYZ,bXYZ@dmndTpdmddĈvuedLview$lumimeas $tech0 rTRC< gTRC< bTRC< textCopyright (c) 1998 Hewlett-Packard CompanydescsRGB IEC61966-2.1sRGB IEC61966-2.1XYZ QXYZ XYZ o8XYZ bXYZ $ descIEC http://www.iec.chIEC http://www.iec.chdesc.IEC 61966-2.1 Default RGB colour space - sRGB.IEC 61966-2.1 Default RGB colour space - sRGBdesc,Reference Viewing Condition in IEC61966-2.1,Reference Viewing Condition in IEC61966-2.1view_. \XYZ L VPWmeassig CRT curv #(-27;@EJOTY^chmrw| %+28>ELRY`gnu| &/8AKT]gqz !-8COZfr~ -;HUcq~ +:IXgw'7HYj{+=Oat 2FZn  % : O d y  ' = T j " 9 Q i  * C \ u & @ Z t .Id %A^z &Ca~1Om&Ed#Cc'Ij­4Vx&IlAe@e Ek*Qw;c*R{Gp@j>i  A l !!H!u!!!"'"U"""# #8#f###$$M$|$$% %8%h%%%&'&W&&&''I'z''( (?(q(())8)k))**5*h**++6+i++,,9,n,,- -A-v--..L.../$/Z///050l0011J1112*2c223 3F3334+4e4455M555676r667$7`7788P8899B999:6:t::;-;k;;<'vvwVwxxnxy*yyzFz{{c{|!||}A}~~b~#G k͂0WGrׇ;iΉ3dʋ0cʍ1fΏ6n֑?zM _ɖ4 uL$h՛BdҞ@ i ءG&vVǥ8nRĩ7u\­D­-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)Km&File written by Adobe Photoshop 5.2!Adobed@ۄ^ @@@  ??? JFIFHHzPhotoshop 3.08BIMxHH@R(,, `,- ^&'8BIMHH8BIM x8BIM8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM@@8BIM8BIM epP`IJFIFHH&File written by Adobe Photoshop 5.2Adobedۄ            p"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?j4Cx7_oo}i?y_lmmN@}? `%A_jYA['~ĉt>-CFS?  *>zKOعW[S_Ж ߤnp=6(Dm[ ­HgwS)"ߢ K-oJmWt=K ]Hײ48r#y6j`RI$E$I)I$JRI$8BIM XICC_PROFILE HLinomntrRGB XYZ  1acspMSFTIEC sRGB-HP cprtP3desclwtptbkptrXYZgXYZ,bXYZ@dmndTpdmddĈvuedLview$lumimeas $tech0 rTRC< gTRC< bTRC< textCopyright (c) 1998 Hewlett-Packard CompanydescsRGB IEC61966-2.1sRGB IEC61966-2.1XYZ QXYZ XYZ o8XYZ bXYZ $ descIEC http://www.iec.chIEC http://www.iec.chdesc.IEC 61966-2.1 Default RGB colour space - sRGB.IEC 61966-2.1 Default RGB colour space - sRGBdesc,Reference Viewing Condition in IEC61966-2.1,Reference Viewing Condition in IEC61966-2.1view_. \XYZ L VPWmeassig CRT curv #(-27;@EJOTY^chmrw| %+28>ELRY`gnu| &/8AKT]gqz !-8COZfr~ -;HUcq~ +:IXgw'7HYj{+=Oat 2FZn  % : O d y  ' = T j " 9 Q i  * C \ u & @ Z t .Id %A^z &Ca~1Om&Ed#Cc'Ij­4Vx&IlAe@e Ek*Qw;c*R{Gp@j>i  A l !!H!u!!!"'"U"""# #8#f###$$M$|$$% %8%h%%%&'&W&&&''I'z''( (?(q(())8)k))**5*h**++6+i++,,9,n,,- -A-v--..L.../$/Z///050l0011J1112*2c223 3F3334+4e4455M555676r667$7`7788P8899B999:6:t::;-;k;;<'vvwVwxxnxy*yyzFz{{c{|!||}A}~~b~#G k͂0WGrׇ;iΉ3dʋ0cʍ1fΏ6n֑?zM _ɖ4 uL$h՛BdҞ@ i ءG&vVǥ8nRĩ7u\­D­-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)Km&File written by Adobe Photoshop 5.2!Adobed@ۄb    P!1"23 A45#67B$C%8 !1AQ"2a#3qBb4P56RCSc$dre8sT7DUg  !1AQaq"2PBRb#3rc$45 CTt%6SsDdev  UXK .)Yuw$+K7k­zko=eɷARNh㞹el_ҾGи8o)u,g,GRo-4a%ڼlAk&]ݩ]1­J;!oe ?y 9oLw9t]6Bf ;zSuPg궖K/~qЏ<-s5ڲ2%A64[Uos\g,Y­BѵmN\Ʃ]|3)iy@~~ÆG[1W­_9{9iy 96K]\tx­pAy=YC6y˰w:Ic=-t; \e׾SK6M/IлByk,㴮S{<2_~s}j/_Wz`?y({Gg.ms=}}˴n=~K霚­sS,76FS}+XhC{"޼YykW+H&u'>?N ⚏qـ~ Lѵ|D}NK}-^!;7Hf­2MEklJao^ZW#8t5lAP7[aߔ Ws֚Uzh揩b2O?fPosU{]-JMskVqf­4o|( {KwZo5:o\USs]օ=DS]T­{. -rGV+X޾̏BQ#jO­ʱI FDxa%)=_=|Cu[$}]V|ߪraB4+>vW} 7­.j㝧?;wc3/_:!tNzqIa^?(戣b6c\=y/s>"]5N[km?rLIRRya3-\7]mߚ6򇨇 ];9Ovsz[h-{8i^2cYŬ3Ӟ)xyf? HIUhs w?/]>b/o6 '՟^8FccyeZo]w;뺧t0}L=\­}OyoӨa­b^7­k؏-[>cĀ\WuWo.}[2.Ƿ_Sݩ?׏7h^ ݪ珆Zyg7^bm5;T_*_°`uOᅴ ZCgRXױi5e;l7pfz~ ­ g85­P wt%ȵ:/nO Ͷzl/3q7Kvz3]ξM NYrxơ縖aw^^8-Y a;T"yaZkx=q,3ƃ&_5%j5p^1vP]-uOyɫK=V9BOzEy Y>[/4w>ߥ{rcN/vKp:֕}LS]z.zIS )5R:+4q>y?VC.ove_=i>6D3}ǬVpky%Vu6ϽTntwY/c-{sE!+ c,-Z֖\]>/H\GV>[)?>,  4:֋OC4Gb8D[* f~jKS|>d ;xY(T EK­1'$yh.b:'"UZdzBVX7DXG&<]ƻ_*/;^L"U#^տA^\ChHȯ6诋#*­R29uQH.":o > mSʞ1­s83?\MTWqc2+}[&-V\b d+{uFO)Iź>]]ԗUvKy j&PF k癸Tn/~9_6[*qTy#.!H$)XMd­dF%mWI!zӫMSHWB aIf) ^]:iU4]"vN9 i1G0V܁#''ffcuj<$Hߒ ͫh­Ȇe*v[­Wdp$;2+B)uRJ:j+}K㒤ENF%іKN:{+޽߁.]a*kqO]!KH$1{U*Sr2ZV|-yAbT+9;%f0ɮD!UTJ b$D1"7eC_>Y#GbǃZdI4$}{)0rWGLOEK]'k?aV}Q P^9[*9\V#Yֻd9}>b" +:{tqljkNr0frl@Dd+­2KFBPeFg OWdMaRA#M2 ­Ҫ+)s׽ߙ|[i4Np\L E?X­n3`AgZ?Z1Rp8BJks2ʦ0#Gl]eHj-lNz>RIEX)&Ce qy՛NB}hzPETH*ޢ袦<~>_Eڪ{}ECe]I'-p0eli:IPz@F[ nQaS­VrNy\+$ܐȥ}@M[*wZ[­F68gL:/\TC/܎.^ |{]S{ NQǗMeC0e[ԿC5TPB4dH_!"vkm}YպW졳"E|V\Zբnu^UUT!ETqw vCt^_]鬘U&uYHCAg^K:nڂ;sv$*^ ­LPWHVzYKb]ꅳFccXV"1ψu/LcQ e3H%T]Q\*.Ƕb*5d~&#lBNc֍+Lt*"m8a(,i"4[oFO{]?W`iuReA$TU2-*/Pl!t(@H^4‘iͱ]D؇U2j>;voM&͋k0St-R|HWb( ))\uDC$f<s gV5酺Vh U]Malj{N8­.ׇnE(Ni!B6`uTT6]sbmHf`> ],96SҎd*}>3[$M!۪&k$UTQ{)}GC4*tPʉ3 ؊­N%k.[aVi+1h&M yڊ!9 k_1u$P[2ꤍpDz7GER(J=Z$OR] n;UЏVvT KqYAdV"VLw^Tޛhkh/r{m6ɰ͓dA%V­ vB8­$rURMyI:SEUT{e߮(I­]I5 ۨ|WAͨz;ЌtaNL1B3$=W1^bC(]"dxtu&Dq6n%Pbɹ.6!; 4f?G_*C|+ݤ󔼰!&:<m /H[|+ Ц qPA 5ߒ9=MM\=uFUU{cn(jjjZ).GLYAc DM;*\Q5vzJ&@^m)+!J"<_3EiEDE4CD*&NSQ7Џv*JfCPA:i-QShUp:U@QD>]̾-:`[H̢MҲLHP5qR G­ #^gzLܮu*Wu%b|26Q};7QN0od-"o 9+i:\ Kia?c> Z1XU ΂ҧI8 RX0DINTf"%]͎9>[In\(S"im>-{;BG}Z^q$M hIKY4f׾ B-<V^hMĤ( ­ߩ qމ_kz}+62@cOWɒs^&Gl76˷ v32@ ;ӽ$)7! Q@;}"*""l 'k+iq]G@PK6ҐGf,@z#iI,.ĊȆs'3qÝum_ v­ 8_S6Z ~-+&H%$tpZTE_rPDd&DU%M&ɡNِJV Nѱ­uee/zCP2]TtD& YE:LuFsr"k΄R-zKI"?W­T4mExF`-n>Z("""mB*:UMwkö^wV`M&_>i3s| a.Mi/_GC)ߊֿ4ȲИ4 ,9Qi_Nw`rSaqO͸{Yca2DεP\;F3T5g)8EبRD r­jee)j.'5n­_VͦJ$<2*EִݬP3 ee !n4Lvp28W-Ugߵ_m:d -trg_}\q<1FW­tMmac9  .#eIote}t+BI FddjC4A٣]NTUUM|­U\*\N~qƷN(&Ex\>ؾ0>ʱW@|M؁[rSX-׫­V^ {>n Sϟ%!#=&9bjaSu eq9=۫L-RkHuErUHھ[d%QwR^_֋)1sU-3GSȣV}}V{8rKa?e,٢{y+_-ru<N5bLX6̻+*ceT=սq^#Y5Rq0V dRk+NZ*.mZqOSc tgzRCڛEey R$_ }.߂k8$22C; ĜZǝq'g,a\ƮG ϖ!­0ݞgeG=4ck@| SeUK ϼ;_q)`]4bOl,Lrw.7~qnHJјMH P+,qP1!izm[Gu!~KuWE# 0㺩WX{pƧ̪RM S1btH̺M,h\Ĺ0ZAq&yr?ܟj߀>}Kr)egǩ=gX~GE;=s\-z­ 猁w6yȷD-Qxmǵ1SJ(` |ʰ-)y_ s5@QǕN:7kL(jiX}vZell'nfqf-`O_] >Xe1OeRs_^Y|Ӎ#^1#ۗn[Kᙒ@c0R9 ۊ() t'W--/kCRjSD,`VBAݴ{ zc˩-+  {pNtXZni(#-LS Y?2~2 8Y嶣YCbP)HrY™K۳.~ŝۣ8]/a kfR5o g! D#˲!hewT +N8Smqr2_c^٧8ŵi+`}Ca,5aօL_F\GcUc.6Y>^1Y0sދ,'-Ӵ5[ȴܞRp"Kq0tZON!cTWJ(.ٳ;Uc< /GY,w '(8gtv5 .?+\{"ilԔYG?YdQ׷|Ԍռ٧3WZ %uDAOs)撶(㋰PdT,TII9=~-*'lb|_:x\mq?jZ?_e}ϙϯSñ೯/F9Ӟ+xJ|/;_<.?}H.Gf}f\)­ƚ u@|W`֥zz J-΢Ֆ {0Cb.­`Q9cS9%f8\[f!2 K}­n+E.< ̀QH=]Um VӅr{~ En4ɲ ?^FҷSrV­H趵Սܶ2U[ n)c:NN=%ɯk &lsBnE[g㈧fR\Sj[gzkBh8t±9Bp,lIHocsЛLg?0N-n,bhH*GB"rI##(-ӧ -R0o[{a 1/ƅ+ %m6DTlcZ&w-g[T8t7HUQq0|7&90  HHzZM`vӢ­޼OJGc1m|jN7ן:Y7FZG,zJvn'uq?ytIM$݆SK ߻$D\z\­ѿ8|~"xgKX!)H/6-ǔӼX܍ m5=渰[ kI<ook [Pہ83Kxh(]5 ;3 nl/[E4 sƉkuRKss|蹵w0'*\ nc,ZiuRoj x8 ^-or= bׂa\ǚd-@`$,XkQ&nl{*E6..0o2K X$ #C$4pHrY7RF<R+W \ 9۟hZ]mۙ"\m2(K^48g:s2>b:*)')o €#"ҋ­CSn`I夂 ajӶ H-zz%Y8T- =Wʘ+8_ZAXpe+A3ꉂ6L7:bN7[VTn޸UgLel­ލȸվ.|1p*fgM9&#'a |$*=mYII=ˀڸgQA IYewIXIm7(>VI_*n4tDbNA7ڃtӛc+q'>j QAD<1­V*Fce1mV?~9Tga{:ċpUgJ͚@G ĨnT\Tjq4S :_R~6iY<Ip }6$ #q }$LGD{n] D {{xBܟq3&FׇmK͂Y5}.u3뉉 _QC1y׊B/O>R7톰LEO_ })mв%-JM6S~ 7uFGaM&d*׳=$w@W,zmjd&Q{N*@Qo⤺ ;־y[F=Lً ZIH5hm2lͣ Mx؍m@%o,xb$¿#$=d߲c´|K- T Uxtb-­s(|8x]Roٕ5ds#­gw3pQt?k1D$6{x֡,Em,3Dډ68M[^*8Ec-B;'К evՎoNj iˍ]e WHĄ\OEޚu0Ȇ 0ǣ{މh}DzYP+$z7[doٓ&KU864O"h]ZI'S,[nQu43HVg!/ ɷp݊icf{^7'0T~p}1/*M{_ο:]6خk =Ѱ̇^)o'-ߜla @ko zS]wsݙ ,o{o+̊r( |y_•ےXߤNeۣ+;<;M*ydĎ6tnv"f<)PsȂpΖn]>A-s1K2 *Z~/& ­ULxGnXbWn*"O 8cC uܖi b\fMINqE텉':bx7iVo¡,{ME!Rs?"U|uokj0c7&79 xR*\g`< 7# 2 Ek}B糇 ݎSrTcAOcsKm#)-ox򪰕V31-nS4DVd0'uV޻SsAaT=ԇ+,S#nX7\M٢%I,`­+ ?wHӁc1B1hMy>Z HoԜ7K>qv<)"<~_8LI qt^,m؏X#j [Wv@S%.WKu/OM X \u9uF&vW 7up<~K;o­:oZFk'x~ꛋ>:C}<nn] ř/|FzoCwE.܏0#iyb/$hG ,F᱿M':EEk%70fq( zӅn]L ?%(!DwkI[ZWE{7c|,f,xs6cQtQãPVI0Ooחv᷑ GH0( e;eM$@.  \rq5$5 Ѹ l4㰹 ;VŶbfz";6tf Vԥ7RE)(O.cUMb}d3iF: 9"LN/qxޯZC@mVTV[ࢳŨ{{[ށXů"`XVi4R[.DKX,.I ~c,&L#ȁ@CZXI?rk {8d`#_. "pA=%X=0­o;ĩHl-L!w`W+Le^-âK哘d" *o\il`1D* A ۿbtmsm*;F,ÉU Z&P h _+Ԋ\Xy{0쫍7*57­T­r@{c_wَ@­%*|^pOL{eQ,{Yȫ/V7)Fg[n}Ty\VYnIyeD}QxUE|\hT򍌻~Kv(Mu#9e$ԱEHd ʴ NL#/R<t ̒&[^mǛ3%75 ~/#ݮt ~ dq^]'@>8ǀem[3EE bX1Sb6:d6w1؋\̏kdH W<\϶6!)W{n1@I"G0مxلm`udq$l0Go5Xj4 "Ĉ-)6V`tVHGRJI44\I$"ʻkף  eeڢ@ωޗ~ jl|yw z$+ĂE<w;} ;t­vuv ­X9-mIj<_ gz!puf^ {mr k2J# ZNa2V&oE{w dR?3%m "ečK­VPe_%2|}1i5) T­a3-sW+f8#`q`*Op#2GYk_ Ӧm7K.QĄp09ڇ2Ff# BpXUlXHT{e۾X @P$^5#`]Z) Fۖe9^oܿB #+`,CX7=\l04GHt^omOfo25HXIDF%H7ЬOz,I/}F"l. DZ9V&nl0_Xo?~%wp­n# q­0,A:UV8w­)|AA'ĒMr `4 \O0n/}űE٘'iyYhqKT5n𫻚fiwoL I&~YۙgHƦM\l\:,7*_&<~^xRu6[JkBs~~jb|W8|t\O]*ƷZPuD ^JF^W3-VcQo<VVbneW&^*NbbF >oͶ;ߜxvO5B`Ym`@6_ǿ&'0dP+kDr p6971idp`A[؋ěH3<@d(IJmcӁ8ԖD x9X)-45=nQI7YD qU/bVxf$HQb~\񤌹m$MŘ3ZS1,la^23G΅.}g34`mVSX'[3n6W+Bd-.iǎ41$^&ڸp_WtGOL#wL=yC 3_gMoynjwp8GX,^Ha. ޏBDٵKdߒXB mk*#&\#Vȟqd#X{_ϰ|)+u,4>b+Ecgal/hG0@U16j鱵OOK:ly?gPM?2ۉV nn:>K1bx$ړtڌ8rvZNmc{# mF}57i}q*C p#Rda "z-V' &h9M Xʲ׎=5i7 G[ͤud=կx4@p­;DHfl2Q `FoHxڑunzmʶ1JI"S$jk` (ŋ2 Z{3D[HbrP ̪HA٦TtSLro!| UGٙ`+O($[k {&t5!K?Pr@n$l$c(5PYcr,m a4u#;$:2,q _( 1lJD N9U4Dn8\c1N[ua>*MC?2qp[\;m@HUVnPPElz qlo9ϣZGlJc\=5\bH Y!٘%mb ^;%~Ɖv$`+H1~5Gĩ|t@GVWkW%}Nk{|ŗ_Z'7=5.^eθ|+%?~]??Lkoe?\R?yyIW?6n?Gx9Őg\<trˏ4;hzWFx}^L/~Ree{ ?:[#6s?C:ymf` NwH7ǍµE%񨄷:C°6LL ^4e{e;wa ­q|><5;ٍՌVc y~Z|ri7OQk2ILBh.@Hӯd ]}t ezk1&/a­bBԈEB>mc D#ȰG}'FPq͘V6­1Xdq[=g7Gg%eY|EF@Hb4oS—M++T] T#G·GS9u .؛824L~X­|Tb0ouygn-:fF'C_>Z]9 VN=cYd~C@P~GuAÇgMFyB|6o2B,W)'Gq%C[MIf@I&lJ8\(j:guEzbZŽ8R<1TGfd辖z-,m <迖tٔ,彤$[!ʌal؃vAVJ16va 8G2;v4 62a~mIm 0%#&VKM&/|HW-O)b ^ʘ- =U*Hcz c]geGyA'SX\3[ ڡ2#( ܞQ^uM؏oLBˏvz:UIa M>1Dйߍˈ{x­>r1=yq78_uf\iyr\"^M8lYM"cKy."Xj O(,n lw[X?L%/-I!J)1VJ}[­'-{j F4are4O 'c]gݚ]֌}KT} +޼m ̺Hëi7@yc_Rv1ai H*Lmo-"TrBHQ#­rt,­)­­4M­~_Q"hv wHn\uzĒ8g4= Td Ei[jyKsu ӥuzaM \tmO nm z)zq( )N&08ԊJ_|.6'˽ǧZqiE΃9*( + "Y{׶Y(;ޣQ)$ݑ13V8]@{i@:CsnNʛ\ێaj4*<&.ױl/MC&ry`BHշF]G7FK-Ȱw:ym |e7N!Uh܇ҬU@R]1afD@wd-ǜٲ94+(m(7BݜidDo扬K?"C*eӏR'W2ޖ71T7xznwpE$N;~ a\)w婽QD/ۊ0:xXF.]qRp8QnhH&QN(1`+c:im.-q?=o!mr8c=d*ZI[Ǎ+*&_!np­>LwaG=4ˋ-،2чnxSoF4D)b*ӯ=:kC ‡IŇǢ`OM3DOe_;­=r~=ϔs] U)-ܚ̒JAE;/.oJ4G xåN<n j?[Ms, 4Qju*7,#F 73rNg:ͶqgsEP Y}b4gZ4]s41 ѽ1C4& |VдV}m#Tq3ji1p?-u}&2BZ v 7hS`ï.+Nu#HE&ΦBͰޗ$HBܛ/n6췫m_Uc?9TC1$4OZ"X=9( P WmGLc8U*x5=",q9˕i5*eb^tN^!0G­4;Vq9޻:pM5f\/{xGoAi p"AX{~z۲΅­°5ߘ#8ԦgYs@kz0 b>nyhmHn= Z<\m) ­Í=0 '&cRUOK0"{XĒiċ#9M܀w摘 8J3F"Hߖs#@G9[@Wzp`WL;yk+P|T`Ԥ>kP 0F {i!2Y ;\U.tw@:-9ߢ2ƴ%ǁa O~ V WFpXV(^סX~<]zgGUOA>^O1??%x_>Κ\|v g~1k}W&?._?/Se^G)rW#<OUiG>OÛrW5o>5롗OWGuם^<=>*t.|</WWO|~.}ş ::Rz|}5?ZYH\+ 1TSʻeb„ FTש5 '#-HL߈wz>$ MRE/b9hhYA|HiHv]VFUw14,wkr%DjhrW9 $~?J㶿&U,MUzjxUAy S̑J998Tp+VV|%k顿, `y,QC360Wzo8)V)ˣQ63#xʷG`ȯ E`ɴilrOiP2"Aok+"VSmGZjIXm2mhV]5<]h>Nd;<ġ&R 5YA K"'|O-L GP­I,zVNVa㜴 c_F+P*H(26W f6[Zcl "5%%e阳+-[R:y :8q+\.붳?@&Xyc䀬kHgAbz |BþyõVt=ZԃO~G_6{tG^fAF/­o|)UA3[X :t'kK6vI#I0+ Li,I* *ORtKT[lB2E7;?Óƅc4PFe%v m bTU$P•7_G ۧ͵]Cu܂Ҁ5\K"X:7o_G_H̆N­uJJ΂߾Hg D#ONLdzuI C,< 3 )ջYrZJ6]ҝ%.o(\>`Dxk ^?SLG2[P­sܪTi\<K9yq; Hj}՝#;.9'簷$iiʎH,ꢽbis 52[a)`pbz5! 2+JRV:1)O%{ydd9% ǿJ4<aK-5B2+l.;8-y iu SpD;A=5ayer;u9Gsw{>RACHƸ3sch$||qw6Yg& %Msnĸ|rY[Ė$;OA-j@1­ ]-.si<"=>DU!^G_nj1>4UJ6|;I?Nj042Q՗!f%L[AvkerhߤEg/uCn1[/.${ʪ)j`!6#ki9. akܪ4dY6B\T IlFFG jV?&­#s@EJ(4.N!]S]~ UҤJ^ ]hUJ!}cc#h+8$%/n*#zEPzh }X֯C(&{TVR-%t7PV G=ZE;26$ __8(z ­F ӲZ>׾q Mk⦗e!o~@YEA|͏eBewrmȥZF3I$G-VRs+f=E:7rF ||l#7%:ԪmS{<&h ^G5#nC:XX ʜwj'g\,nCr%5Y1ªhx+w,?LGuc,}$W:,j %s'REZK[ #)o糕'0 XͥvYPnE$ [c-$.mVi_Ph{ӯٿ"H|4XP{pwIU !v:u:Ip@bڢMc.R*Z5@.X4 ?QlmEVG,.EHvJJHQVQ%'w5<܏l~_EGgruIe C9Pf*4,:l*w v?n<nuk9TK5\s3ld1dt@j<|k#쵅%ȽVVVrSG}6n[ⱐEm >I.YWOsՏtK+E?(KHccy-I ,-­%"S{k rxAT0cƥ' RPr,R{OMV(]isp?6VvsmZI"(cg$M{+2P=kjF­3ZV @5MF&HJ;;(B㢵$#$vn DWB,X#54v]gW0$t_­Ѽ9bI+QPUyG߫I lGMU^}j)db[Y j$=A\^= R$X˾Vy:!}wXaKB UbNcVy%)SNT:­ h:~ӟuM+' ?IVHCt;zhEd5??_m}?'?1xxH<q30^rilVWs)8s9\r9nCUe";wEGV/1K Ao 6B$盞\ wb񶶜gr,"FL!I%|@⦀㞢SgsZJ<s8mr|֌3GcsuvwH-_X屐'";!kA 7 -d+LKoc4{i]­ 6|s5-̊mk/NB: lFj}IjqDBOvW~b$Ic'F e3FCR ɷ˩s\m$Rz/y--IiiM%˗X00sok|+@|GnS^E%O-ѵzΨUSSEki_yLPҟ\b%bi27k} H^ۡZ|m?xX&Qh3J۱J­AMXY9/ʵժ&m­Ă' Las(k+:+j_OK✊%khL #k,FF5JdaF%JϽlu$_wm)ͥWEol)1$D2W3eq [E+-5Q!S5­5K*ercdy2X>UI~dDwTe=c5|i%XGuvvt^C"%PcbfQK\o%|3rV1oŏIim k aСB!*8xe[n Gj:3!2-fV#-#y>KNб!­[ ^Uei#\T9@h]p A!IpJ+E9Gh}4%i+Kyq1ڬhçrt978 {}2'_ٮGY3H"/;W%+7-r<V9B}Y}>3@ȯm]Zz,0Ae.-Ya㸖XײJci(jG JRtص 5$AQ(1ȑ(ڪQI*T il8]^| usgC7MIpMH7r[&wQU(ᗥdvl0$yxX/I3Ǝog­  ש;P.6ZKEhEVaaqAQHq-Ўk"t2 FrV>ͤHnaUlUFR0ı&75i "lD 5 MYیȳ,*#xm馊@ R:j o%zXsL|wՅ/G<@E=>!Շ}c&c5'Aw<FEi;[{˘mi($e}YqKEg,1#Ta ?4jd2FKnOHzM[}/.Ĵ2XoRDXYo1.Z♌). B^q2w~ ` I";ZMqV:\fNec-IR|%rB 2 Վ o-$7_i({+ y EО+pdw2E,¥3}wm-77P=­bh6at  W Ru FHĜGDB IOV0Z_&ٕK.VESq[ͲYI!Cqm$xܖS_ؾ{Lu;o1o UшQw66)%3<,K p%#,(d!O1C$WwiR^y#y~ |1fX!3PMuĤZ'~:TL(>/'O!9$+d!;wɊi*j)M`\V Tik<k%T^?a 8-Gi$#e: YFK GylN[kM-ŬH% y;:(1r<%.caoUue܈ vhSY:<s e^ {s0iK n(=FY.d2t&pT Av1""Iu[g=WD̀3{1G7S é]ESGR(>#:PVɼ8V Wj F4sMH'f+?_tmxh=,DQHA_mG#(ƅ[צqK-\ښ*6:WW-kֽ{=@uVƃJ={+ﮤt R12F'L{f$VA NŪ9YhM줁%YYoב LJ8"{xs;V7VvO;a!_ĹE\ 5Bc+F#k|aq<,SU 5M|׏q)idkHR7o;:0=ice.JӐzk.s+,*/'pVI{I CeO#EeZr98S GWK%!gޚcT #0ƅuksguksay]-ݼ%w6SqzZ+MyCE]E(K mĭ5FtUňE T{u ;'ޛU7+J!n٥ D2w5I.$ նXVqbaHlm兾BF@lҽ5+ sWl7KGw|m]5zSY Y ,IɌ_GB rUJT>3`.%[qA(&3Ⱥ*ռh*GS=)qar%Y3-/5*L;{ya! K2zH͵A`umhFb|@pǧj۬g'v0X![Rh昡(V`g%cr٨/Y[{+Ah-C p[O V4śss3;oZ5 Jj4dRMWzuRA%Y[`T13>27t"aOrĀ2"ZFh\RkZV\K\D˾$n6 u'>F??C6CN;vDMWi6",_#%_߸j+#L q#out,6TjI*҅ |R5=y*:՘mZGmP] vZ)Z{=DN  (}>' <h*&gc )ЀF % Wx6<ծcmi!{NEkuƽ wwH_+\y7=slRqOpmO&e$8 bXq+]N+?U探GZ})ufh6pUnCպ*T'J5ZCJ%ITaE#h*=餀^`,H"1bƊAId,5 ^BHI4IʅU*̏޽i汊]y \)i 5=5է1|sCnsJ Lm-Hi}$`nQy8M& w*g24rEK}vS2%1x $H\Bm99^+H!}!XB^ -WW[^ɓMh2EEmu9!.$КiA4(=a#ċ5 . SRMM1J ;R{i'D%XGHףb!rxVA6_x!Ce}:*L6Z@cng/Oy)ȓCs뻻K#y+icƮ&$M~,ry[-[%KDoͺ_ R*K?O}KOBA1dvfb3/Fs9ٜrIis3ȭ{ޱ}}t1l]ܸMom4g!qe/ԀCpW/!=Q5paVf+F|j@d4eT,!{SHL'˼PrHƵ&RgVX|CIӤJ>/ٿ©'Gbo0HICYPvu|4R&Ir%CX$ڞ4KX%|Ri7\I>Qdel}\=&8lVp mf靈rվRVs5.f7^l;y+ $in|qolm'cܲhT:jL-ߤv<_ۭ7q'[XJ27/|JIC(c}O=Xy.x}6#{&hr?D@;Ӕp?V#Aez Kh1MY|ۥڵʽ ԪSqk|37{ C4[Qee "ҔծVekx0?IyjYeRI&F֣*.lhWK`C͒,7;$'$W?٩n#VK+[wV ;'nhhuW"a. )M *tb  PnrYG,™ :,*$E.>  jEE{hV|,z׭i۪fJrE}@E}A~M_qkѯF6onT~ƻMeF#5H.#TViVvDUxBJ%`y/eԒ-kJ6ET2 )"3'돧xi1ޗZ;̅l[Z"m K$wBީzmv>oa^KX\0VP V7 CΔqܮGvaFKm:o3C㠤b% jYys@vAռW $PE cqԉwcи1D,6KvfTEa7: q#zywL4|<5^J=7;LCOk&Z (*-\TԩXrƓ|qgZmZGmİ?巆"Wc=52fP!f0ukybr0,ʩr%q(!MM*O@*tlI"xA"udU׽:v!aH(%-WjhRa}$!S?NQH=UN tgMĶj, I.u4kGoZd+,L=bJ0z.W$IN&;h bOPVRMQȢ $1S"2CD|n>)Z.nRUcR %BIzP#+G!b9-H'PH)òdjW]yxPMqW{7y>u.;G:ϋz{$-b cuZp&+{d3|B{Ym |k tfm._20ܭՕݴ[>\_Z5R,z~0K2)$l^ 5I5cuJnBNȩuq[d#]K ϐh_u0[߬*,u-k#kaEsq,boapF@ƪܤY n=gp%7,FY&AЄ}%q77ܥB;ݠ\G!,ijTSuٮ'Y+X ټJF$O颯tyf$ig/1|HR+l$(W5qOwjXm? 鮒(hPPPzւ:S]דK|N(iE ) :='/]w$}5J/X{?6$;ۢF<*)AM_I}=W$KXbs%,Ҳ.ӡ;F+j@f]$RSnE:%4UO C0OD`ƆMTj{4%oR?Q♢¿$-\\kmg-p--Dfkii3HY_rO6֗vXFnm qMa}#c`,%첯dUa_՛53.[l}!$66xqVx'el3bG9yM:m_cvW1adk릃-\,Q;mv29Y80[Y;Oܺ jۅ->cEFI2BX,}ƞ SX&7\7v8h"ƒ7ЍCopi#?x l`M_mhkAQ+9迪&KW]Jm5FM%(^9PNlc@5-PY(( Ah'\-bEvjS:WX$Ym݅cV4J#oİBB#fM:miFߓ\2|6|n$/wnLK"uzR񝈊LwTҊ줡dJ0?A$U۵vn Y{_qwjDVpzF EGVBHpkZH scsoosu-2*KPᥟ!/TQ||u,*_1A_~hYVŶgYlIM*;a3eǍRBTw4vkE>h5Fif1=_i_Aң_^d7/-}WW_^"ov_wCqoC{;~׿^tP~wqY\w/Ũxo~CAuu_߅_u\z]WxfW{S]e'꿞{ݱvۯL^sOl۫Ө~o|~?/v?639_˯/ojV۸?Ͼ4_7Oi?7̟?k?/߉>*v{_߿o][SfQ~_MX54){?{{/^ϯuߓContentsData Object 111 ` 2Z0`}.5m5mImage1Contents({( PIC2d{PC2Le(( ʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P 3Y!#{sHEpV +`` >BF:\trellix files\work files\Drafting Tools\Drafting Tools c up.gifup(z( hPIC2dzPC2Le(( hʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3Data Object 112 ` 2Z0`}./=m/=mImage1ContentsData Object 113 ` 2Z0`}./=m/=mffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P  x1I2 k+V +`` DF:\trellix files\work files\Drafting Tools\Drafting Tools c down.gifdownContentsData Object 130 ` 2Z0`}./=m/=mImage12Contents((e4PIC2dPC2Le((e4ʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P 1J֤RDhat,O5td%/: 4-FFFb"e4%Z0J=w2x͞@ mnŅ~vTІ.atUϟTNHkWy-A~gnA˯Ч'b." i]|fT{3RyhhZ6?H% ޝ+NLV{1(ZYyR϶%OY-Kk mVBny߄_[[Z _ $ e-!L0ҟd19uRP@…>40W&dT3,3~jFРlЂ~hЖ&)HG{/Wt]^&6¯)b")uL+C)CWKU+zr?gsF[&<PXVJoΘL!=#!x6q AQeOAm>!ZG):845>l|fC7<8tGYV:+Sz8f:I mND.E7A)v>9xPGҲscZjͱ2Hi+ nj 7*6S7TAY.EV +``esOC:\Program Files\Trellix Web\Images\Graphics\Miscellaneous\History\mail box.gif;ZKn1p _P x`@ %0X?ɰ@`'h,Piw/40Xn0cA PlaV$B0?M\ؕE (h +H! p0H0=NB]>tX]Z<1T0-A.i0fTy`C TP@X6v0@` /2v:h,Tl@]mTZX+sy JƐAPň :TData Object 132 ` 2Z0`}./=m%ljImage1&0v(ContentsData Object 138 ` 2Z0`}./=m/=m     "%&')*+,-./01546&ky`Պ +t`AKn=+2\0Aj(' U ln` c `r{+ rh S[BrR\2lбD0AP9 .Pp2*2"2x0s5߼ ,(#%LGCtK7 0-5!)(c)1998 DeMorgan Industries Corp.USSPCMT;nit=====================c scNullObject===================g?GA@V +AText  V +``<2s2BC:\Program Files\Trellix Web\Images\Animations\??Objects\mailbox.gifCDataObjectRef FF\ Embedding 3F\Data Object 155V +``n\@(V +``LImage pasted from clipboard. M:?x?CDataObjectRef FContents  zImage1:;Data Object 140   ` 2Z0`}.`WFm`WFmImage1 "(;(PIC2d;PC2Le((ʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P 7 HKoj6|@ۻA漛+7?A$ҙkR^u(h!kn7Kiu|geXQLG89y̼܈LmB[\f*;^y([nN;Ī!rQK#QG÷) ":ck9]v6*h5P'DtwBY:_y_MMt'Vvm/c&W=z^C?qK1SX=`,P _Qi/eU ^TIi9 2Ih8K!sg2kgg6S(9E/\sŦVy98/d 2 2 |> ۇ:_'UoC]fMl8}nDgnw1R(vqP˯Gv_hrt6$(>'onc`) KD]F v?i)pu#^ZNx6'f d[v>&t(mNe xѭQ }+O~oRʓȜ$k9["bν#c?qn{4WĮ.mꠦ PeJ20B\ѷ6H6Y="Pk5k-MqméZuc%o=27nbpqoJ> ܆lt>z+@M5!^aTpa2GKHTXTMT;RFju_ny Ѭj(j1`''-gE)ITeI b@KzA24FEiC%;,r)a5AТTZ;uuyt6`rN~ >-{g"d97USj'Blߕ{]e1:tvu:eXkLڹȕ ĹTPCDž4a(yy5;4-8䁆HZV ,o f|Z-"5獱|=G0Q.uq>us "0vJ++~ij}}K tycY|d)uSulۥx.P k!a~bG V! rfufɶ p^"Ѯ*ꀉQfQќ^4wbZ!6Qh9 Z˲z}@kı˽N4#jm@ ͜tkpN-58@9D^ '\aDYYQ$jMƌ'U1%à Qɤ"YۏF RW226T20&^~L@HGP2,pDEM^z+ @C Q&i@c>o L} j!lxtfn.Yp6UbtlC^ }PqqEot !muLO*^%gz/͙S0#KL2TMTJW9a z ~>;> jb>ϝ)/&OW*zJK+uiE 65 Vy+,(-}§~ԋ(*65GC όH\w> %:LFw+9>ä?\a9&OĢշ%`=$E)?^CuM?!k,ˋd|p5 rND ^H-_丄nbt"ԏK.k&0xZM>e$(?@:OD464n{酞u@6O|9(ms{5Xgc \؊69og\+GQc#WX4db17S<ޗu{=@Vd&9{M,H˔lm!XPϚ3#Q],OL۶5&P\ ]nثzli,ϸ)fmHb U OȞ Z3y5anSL`9"XWJd"5[B'+6ō]Z\XtQPDVw P缸%:9IqNt n ?'GVQGQšGr3f f6L ""XIFD"먥9  kӑ>6+1cvO}8䁨a&bg `@BZ|Y66"?_[rRLʅq/.g|H7u㿪4K)u46XPfZGRˉ5d e^7 ޫ't+X3I]׼Q%>04w^ M(uO]DGN?2h_ ^8D­3L/u1t+ Sq^*usDKNz6hH7FYڋ7p3QAsǁӿ,{@0M^]5pF\A\:ͨp?ؤ 슟W Isc'OaEX <ؽ : [Ga|CM?U!0rA#? _0cGR82+XC/ec{ ,<*2aupp]#~Xƨ|rc蕚hq\/Q nNK bcv3<fƥk jGz?5hku`ܯV>ImpGy dT' N&Rm3ܸu$xfȳe[1^'wrںo{0|"t 7f-㰨wHx m9}FA0QAׅxQ&S˂ZuV午of΀L7"4*24-yT`y ǽÞl X9{B&<CD*G9צZA;Jy KFPmY;/87ؘ6U1L#-eQ͡D43tv&Ţ -{ AO_eF(vge8۰?­p>wxUV(M$ 0K;jhP@,'L?o:B*&y ŗUx5t­Ap­TQF2ӟm:aG B8ib6[He -1߁S GGnS H\?XRwi>qc,ܩ)ѧ`bڗ GKf<M d⿂kebby Yr-P^z;"2wXj£ݙ/4oI?x v>Q?]<Ufbn꼩IxՋko[[CXΪ`[b 05{ +09YˢW2DQJKlݫ4Wr<99ř;0W0GJd~q|N֢ 6Hɏ^ރcf  b @b0 tr[f|5vbw'5^B]G\ ZZ_-Rk~fObSB;q+pӴT.l۟7P~˦]9բΡ6uDCm(-txj@aC "Љxzmf|wuժKN"S n=rJ{[h(v3XއcMm!@RX)1l,;\ɿ#y |W枒}ݤ?yeqrg ;P<8!߿ X7-Qy&jQQ%iN JH»hΚ=G'W\TeîLHi 2B] F~tDdk0xl`Q?fQbAf) 03ZmuJ%^qQu s܃, "ʳ\WM ̨VZNR3Z63}E4U`j* /bK ,e'_:IG# .Ip1wj^MgӞ)yJp .zRWzDF]G \h Ę͡&tHLAJ0)?e~ڑƀ*ýsK^JkxiӾw?o!ו_% ~[8-]8h`SoB+'C+hgx6=Mx>!W^5 1ȶ,2~ l"و+r~60H<_H*Qus$ӿ iUkBە#nUs&3{­n^B}Gɟ`ӅtmȗR> vʦxB*.U EaצquOL;c;mUU|pOʘO@݆@֓JGAWrI(/Zb%NjAMAJUlgQo Y OPلnTG,NҢ\IyQ勺L?D'< ,IՋzx Bz79)#\>-jHD2y]/vjK Tvi&ø|uk͡20Z0UDX?%@ {Q 8V%IaF2k~­ƕb#t6@;:` OX..N ~g`Sj>&9XWSO^­0&{sI ikJQǀ_Uxl'e߮yo'aS8q.ow'*ȸ1@D"|wsG mԜ2܆TS?-ˉGH6BҪΦ%ӇwhvF]$6 [WI.2 m"%DSKkAkϺ[JI&fУ)f"$5\Lc_Y۝QR$dGD4شiXqOŹ1TOcl胇{`D/nC^MÁcScY@FVr% \EqM*[p_m!o@7 8"@O#t62qyɺ>1U֔6U'<wrF:*]mPG_'|An[G$* y6*ڍ_ +궟1NAld)0 Aީl]lknuWJ  P0sN [fmVS-pdJr]c{WOhqT] LG2n܄~ ۤ:g$<sON2ELۋtTrT_̒UM'f~L/-xD `e/G#44N<}3Vu%}yiޘ]ÙlSJI{m/c&LF­),6z-f\A258X$W, ((Tqh22;~B!ff`YheMO-gpE{[O&D!wa^ԡŊ+CEsUUm­g`ؔÒ9/ۼۂ/ uϵy[Q!ڎ~81'9g3.|]y0xWCf1ڇwb=Nμx"g~mlJ }@>A4^OD ӕAV7k)6sE A[k\N}m)b_J X `,0 <]Xx(^⎑^tbM}%Ӻ EFV7pwTf:A%? } Q^%We6" k[<ڳb4^ 8iӳ֝I2O -тCGīKھh5WS<;llS~t[i0|'"8LxxY" j*s~8 Z<y{tS J$"S4[W %P]d|C1忒 l:SFHkF7 0K5w6>:ò[pI )L3G9{y9/ptQ8gٰEBUH MOug1ltAb snj¤WX[DnDg֍;ό"X5MCX"IzDI5@]iPA>Csߨf\Q́σLZOjg<޺P2#Lt@Ó *3'Ԯ_`gwZyo<{Cp_kd_ [~S"?QSwB/ԸN,-Fb~ifqByЄө嶑$^]uguRӉq럅)$j"6P&2) ]9E7Sa-E2Y16&*LK­P=p'kJiy7b7U4Ewl4φX Z>;pbQTD C$f pB#Q?i|J6PAF: p̿夳{}t }LVy4" l6Q԰0$KԬ È4\z2BK*7#_ 9# T5پ'C:fȝ$R]  TXV⁲~58SfSÓUS3פ>a԰d E(1f37&oIZs\6q&DCM&*{ƒgIq@˕ sGzhq(R4wCⰈeӼ'5.G[&Qzh7u4[Wk'ş{x%<˚3w~!nW'u} Z_q?, |K-{3'0-ۀڸXFqv ߕ  rDҵVLj“nx#8c!߅6E hf  {M.h%9?PDe8QPg<|1G~>Y\csQmnX͡B ]U~#lp ڇˬ_..3J<o $bJ}}K:e3:;iprBNgÑ&ntt |MkBÊ f=ܧz6T<9^\;oXOֱ<X­L U˼M3n[:9ĢH@:{A3c \iYN=hҶؖrf6^gPڐK24%8FMU4еo Q `y R6[0\"E" $ ­ dt\!uEZaC S­cm-goE^NtpR5k&F 4C/.4 roV#seAfl­p]5#z{l\ݳT; U^ gR6^e9 jB;adxX*ĺ\5F74ezb,O$E5|J%mW-NuMyU-lhm[pvtWU 2yأI).*:fݵ7IpHsb W.l]ߋLg"3Di(j c bX";է"p~~%L]=.UĮR{m@J>;YǹK2luŕc "$w*ș18.ȱ趦݉t #Ug$wYzPJLp  [ ގhJOS֡bIg:>\Y^ i3np͓I(Uє//ar q8PF8@I*JU-ak ͏13E)x03~ =0 042=`7G:iW /uK\u^7rhIuQzotݦĄTURf ;`co2 5Z&k;Q%냟TTŪ?pR2l|MdXpYp6ao8ȿx>4*"i|ͼ  qk`+߅hyA md޾2QyG@jrK!ƸM-ox­ c#Y)z~i0 @ wI !e6.4V~-Ԗf!"^O+CK_M{l  DDmA^;bQܩ6obWM>$  -Ż >FRjC)Lw+{ *YmN­5d.k" a}GdMtT[lmc1"KDH}0aeH~Fpx!Gx=.8 i"ȕl{aSQdj%ّ5 4Út/ 99pq<#mPEQp<i*+X&F@4PD(&+ XI)7Z!Y_nݔrGEs۫_*<+'I^'RҞH“,e6}? !!1 }5BԯoSM0*SIbZ,--ŜjxidɅD< $ .Ҕۯ`yl֝0`vlX@b8+4Vo ثrNnzq.M4r- R؁V{I|Tӹ7aJ$䍿5\;0Nm&'A:CZpYO=EqEZ%:K 70aJ 91eU䌊PȄFx .4n|hyqmd;VSoVlO#]VQ]6\>,!d=8x$­h>y!` 4<M/n_} )&@˚x֏%ƘiKsv")]+c9'P _B?{/ ^eb, BĎ >V|wQ ܋6 qZwU9vo@Muؖ#ܩC<n%Hտ`Ey0T>?0t jyxͪ2it|D#% 'VqQ (_[IVfG =MG&pa̤,Z8ҴBPom9T }1xEݢ^1TgzL.kdJ*ݚw;­Bzx-~bdR8g~2 I$z0<HX­HSU"&9' dF=\ܱBZW$HԼجEuSc|P\­zrqb¹'-2\>>PA*v ,Ί[IEkώkڽI ]_=}DPmMPpj­F MS I >4GeOY>gT p,@J-xi\P_e9Ccx}э|:Μ#B 5PC t"?-a%=x4P8cU6Оuw!r f#aڼ pW­#O|-{,Ho-4}N|S QdϴC3_+fyuuucZp'Ix DE9ܢu=p"+zi8%=WBT֮k{Œ'r<@0F VN~?a6ɮ`7, τZ[s ^3F|*27gd5uGl߻T8;jh2 eR6^VKjf]X%9 +OGdZtK (SujAzjnFj <zzS4Qhd"ʫ5}pDa0_济-YD/䜌,Eh|X2b_A9D{M:6+Fj zI­艘q2K$iUeH2jU] E(pAo6:lƬV.>-TO_0S)2l;D(k=%ɫR>%ܤuoVi.[dv9\/|ĿIӶFX7֫^­KjӉTNt"{{Qj dQpţ<ITx .SGZѩ`l]X_hwxJŁjkp >\M9 PER%D엫O^:1+}01/Ƃv@c>x6'(n"ᖖ(fsȹZ{^ A0ʓc\ˍ{H­7zHh­TvgvJ*Df/ ({/yMWMw ^lƛdo%,_Yu:d0j5,۹X8 v˼5|@7<vؾilkNyRJ­dmwQֻNy`B݂/@/:b^<33q),  0Uy+ЦɶpFh5iE) 7N"].F xk13"hT7cb 4zỂ+'uP+["i _>Sp I­3n@!};{<=WLr d xdqLm!NISH1Î"zhS@0uh{3m3K4` ScOg~f)o cvвVg ߦoXB茄P[ :?R;YwW_{^$tŻv` 0cƎĚCcq/V*{­ֵHܐ+B^ft ha=411";@8BrB-r, f5ϙ+5E0Sų1crЙS"Qep"-1VKdV{tiYy FZDRq_ն|zNVfx";3U}'/*>+Lp@!5VҮnI䫉K5:O"͉ǿ*|%l>:* :nmjC(LC3)ae2wAt~_a*­-ߦri:<)Z h*>|vɋ#sXiw_Rˌp{m69]v0gFNxФv{]Pvȡڊ(\y' ­ nF*^ +nAZT̤ %Z G7_8W2}SԓoiŐi,盈¶sdKnGc9BT@!Оeku/\ū9%_vCn}2hۉChOhC]222V1!LHP+CTgz7/;y.ŮGU5\heɾ*ޯQXj)x.kdR;>w4 EsW+5aG5,طG\Bl/HAxϑGa ҋ+Cp̅-<9|(1wo#F# ʞV?dOZ'd(<3PzدvҬ!jILaC].O[@FR I|-TI(Ƨa߼?٫HcP1`Q.m#;i_-= o5FEwuL1nvR62H@ux0/wirG&&唈yD^6­Tv~N@΁BV*#O-T1$7x.6Z}ܓl2P}A{(R@)})C9mM`. 6kR6ix%np=nnl[Z (K$R›RQpL?C:*Q_7O+:y\lU+"'qb k ҨDsvX_"KRԂi/llhpo; IFsg rs>WYeJLjCAu!J7iV /c31cIu8.'{ 7:k!;Sκ puVlizOO`:$@} O%1R]Nu8u?RWR#ivA_sYZ 페­ xd|@p Q?C"ɤG8`Gw4 J;9a 'iVk­Wc`|k\ϒ)Dk|k^%ůMΜQp^de=u%. ! hl]'42F. m5Pz2hMvzFzGk˜;x/R(ITtO߫\Ýz`ߞA5:W{A5}4t ;^yKz=OFz&R­Di&<$ NꆣJu|t{/56FB4.& 2_2A?jiA C4~p,N_HH8;LfO.̎YZs>x ) T%HvlKp(hk:BFi/Q 53sI蕎=NN[RHR tN؃)ck"pG拣c-suv+ޖ lݼ*w :'_*s<*ga%/wVb/w ((­tG{~AhUts!*X8"V#:OGux#wB8ءf̶cF7MO&cX3Gu&tGCG s.U+!+j[u?g X qXF 6$Iۘ:3Au0kK"30j#8:{h?rj)pX{ d0{|ruG+Fs?ZMY&G^~4U(v}fVqI^d-2\9Bc"kC 5 ¿`Syw亓'yo42M(O& T2_[\W;p+={1; OJ\x!\)L #V(6<@6~ dժKiVQBWDoe654i*9n ('̤Lu2~//@5.P")'eg)RͶT %H,aUK t4)h:80aA55, &KdHDx\qC7Gd­[XR]xd.wSjW*^0)-H1X`O˹ J0´yC­@RIm[ K#f a쮊9 eI|\9ZE%|4i ? <7]}M@XrD ;"ػi٤XαMaR6}TP))iE& 񽒙kq ZAÓmi(QߞȆBt 'Am V- fDP8 ­m]5D +S@3­`S C EnH2%2YZ-Lin5unٴ+[36,O<QA{HWg#1d1#L-,fźrُi5=F .wJ0­*}$ ߶i%x>ԯe1o LQ7In+u Y~ggw dȻdS4 #xxZ,K + F߈#ȤiT1n­_h * 1xiCb/;؎_^`.?߁\h@@Mg[\'D|'wWɈRl% oS@7uW48>!\n c8NHk3Uq8fҩ,IP %LQo B]V!._8 Uu9F5=vw5I-akk52ZtB{dfGljp}o`#fQ|mt3i!`ڹ\7wn1͑wZ)t}~SWp]Hhߚ69>$NGn߫5V*kggI_ʾR߯wv"T| kއN,=tVvrݍVNZ`3V{BmZ#Q3L nbgz#}>K(YruW=ဨKNe3h+­ε,V_L+^WsApŞtx!OTlLgm~&EevCQ­ 'fArj=;_lJa«T /ؗUF"o#ߙFXEI)'SsywҚ C[sZ)x'A$F-G %iE <. ns]չ:2q%cUo+K&s֢@}|sT 1Gn|3>sMFuXѫ]LLUV $>Ґ>laۯ­7;,M6%[:AȥT~B(#x=b}!4(zJYZ$HR Ï&tm@MԉJQ}'U#MXEGRSoM{ 1 E{ =5tW)FKE(uld'5}1g7 #{V­{Z (?$ͧ=]Q%iβ &ĺSV;8籖~ K;dK\^hEԸ7RgLFTyiW],0Tki⛯NEӱ(9rum=7^ I*_ÝB_+eFHABkMQfsQmIpO,fA:m )Jj9SV'2nQ~|J­vpֳc} YfjBMzoTG;l g- }d.[uոudE:F^|b­x'oM"4FwM"$'* H,UURy 42cR lj^`mX^S/.S?e! 'c>MLL7­Ӈ>φ­a]v& ba!_ %Ц$^quk/@Wby]5οvveo",%Y)L%YyI*Mǫ益85fS݀\2]h;{=SAPǟ$%hZ%[YSÌZ(Bݝ|XYBts,|uҩ_?4uDpkT8/o(­ x-` XD'n-WKlcʚL5e RqȦ쥪mV~4}%  |t?NI z9~G4w~N}ucqKyn ܪ kV+ybw M^d x<as R,>u sM ss;`K>󽹞diXf:A0ri-N(Δ2kɻeO?CJ|1>E (WD\Y~#Qݟ&q&ZYC_`mXIŨ*cs0k0s%{N4FS^`Z<?[̒E^KT.j A.Zt ?Wv+a(Q d2EVTHtljt@SSKhft[|3ds\а䣏j[?+/o2 6"qQ)ln4j~Sүrz%x>zwTfiiu)flF1­V~ H/a])ۮxQfĜ9q7εSL (W[{wpsQ}ao5rop&@v‘*l׮[I8-նF ya]eƮ8q}ʙ,5­U;#7UL̒(>H2|@l6H 3"4>KzKvO'ߜl#ek١j-Y Kp l)<+ɧ4y,L܌z%V=Hv?ig! |!˳A2Ǎ-X]k]js:X]­!*}WsD~qt `o/*EFy../+\YZioEq_qh\$ѱWy30=mFNGz:P/!l:ܶS5į ,macm=eek|b7s"9u\ehN.aKR^~[NTmdƴ4sDk[dֿz­=ȉKVZU1Dmw/:_:% U{!D`75pX'D.$z~]Gl8S&xveQrXl\/AiQcqk?Na61s0 2h_I~j\#&Sah—n sN|j]2 '­:NJMi:ݝ5Ϊҝ-d'2Dm_ȍ7/M)csK"8h2Qm\1"m/A9T6hA{KdM肵\­,&I;90!61-\*\\ůWQTHUz t62VzG^6{L)[ [MyRh47e8}pa$|6t( 7EC?| 2T!hCMپӱiXr}Ryb76P3׬ʴӛ!"ina4nmVs 11fA=0@΁TdSmTbP6GƝھ/c9a9AHQԆ1Cvu5%V1p%Z~Q^9ӳ? -8}Pn)gb4< rPL.w[۽n7[Btt­e LM,Dc?+1@BzBȟa'qZ35vIX%LVjA -!Xxkp)5/W~6ނ3"w(1S 0S Ow28 R7 nan8m Z-b>S~^J{ X@8M&4P2ՅN?-b˷'+%kgÌl)d[K߯s`&zP!G&Sak#)F>Y5,:ҳEJa, tU(kHKP#f, y ljSCx"DX*0U$"FY0`a UyèZc);.­;jfk ADH '&b2̹ v mUTCR/`͸kqp1C* A R۪W6/I3L8OV.8­wC.q'LacG­`ЛU7N_V3| 2dY%eM0UeV77 Pposju/sL%fJNo ­^5M[r'm (b'X} ݱ0-x. pCۙՐDuvKUOC(8ú饧]50顽sR:35U9e^T[M D> ɉ.HV} LjU O6u7QD#N5?̓v lzqwqWN4k7y~Ο$)­ZwQ?:OBEI ǃQ­x=btKʻT™rV:yW%bV9|$<^]GDzbr:dfND@0}LWS`,1\Ja^>]6Jwv:ph:ťڮ9sFRl=GS~CfuͰ%"E9 &R ȣAvz`%>s P­(݅s%c]A­=z3 U<W$!t;Z ) ׺)D~-wb2vArSzWBKd[' ]5­\ӁZ ]cRڎbXgj-ظZKlnuhUxՙ>$k K"zHyݘҮ U&gSa`cŖ@4­4 o밙} nGgx,E0϶Crk!$­5Aw4[)<­i­rX5M P4vp~b#+1LJR#-" H*-Y`˰m'I*Ь+ Ju:f&|3;)/Yc\&SNR?ePXp7ͺ J76hEOG[t)KT}L_[^O|Ľݴvի8DG Da|UUz0 xra='XȀb% h;}d> EVp}ܳL/Z(~)v#{M) K*6AI Xx@fղs z!bʁJ  ?.0xHeBTt݊L) a4Aא'[6Mht5).LJЮ3dMi[40+ :1p). z({=-|wxsZ?ff=rmVS7YɮR_W7HvxoNqp$Br y64άR}+%ChApz1>w/7ivB1 CU:rLz UUm9@SKvkDX+O qx'wWM΃+; :\Zu2 ;##J];gk"Nly+ r226Jc-F)-}x:Йe 'f+qC׍1 n_+쥺 F7}m-$e%­9/ͮENAK%%]K벟k­RX(f1{ݍ|W/`!"ѐ _'\Y~ڸfIo `IR%,"2Q$i1Xn7QĪl8 D`OA|?1,.tF+qFY\+W_j[9CXF2{%o1B\TX5B!<(L+Bt7B9㵋dc=&­1#r%j)|?;sI东'2>Rp `DP1z]3֦=KK9N, QzavR41 26tD)T( {N.kX[N=w}!&# f>ү%e*w31 Rȍ8}Uiރ fV j\'ph&ӄr7G($;5ًE 2R f@\x4iaXFH .91L|Z!rn6BMhi>"}D+|S@ĊwO:P[U7Tj ΩHQlҚfg;XsIX;w94 @eF)A08'ҹI=x[܂k#Xx -Qhǯl{t/ !^''  ijuE p*WW˄q#nDdۛۃ H GJ =.Z­2{^T&]:Di'{4T>8]WpK8lOm]pj b\Ts4ULΜ.HԦmHD n GH$̂dvl"=.)@C^x/h=2ȐDRF "[z[5~}$I VE>=x@)(Kִh2M|HWSB zDuLò >FMt+N51=wY7`gyy,YKh^Xc?2b1|8fon vHnȽCkYq\(|Q 9X: uC0~V ­Z0^Xͱ\?em!i<WZQm#d| n&F["0˖>ݹA iV9 @ A=  Q̋kaM@{;I"`l-/n!}c c̬VFsOu[vXUG3ŸM["5aeLVa`ARx4EoCG3.6Xc9tETX#P)lHZzQ&uNOjo !t(+A+)sSQC>,P%W^kڻdr­TE}'rZh2GBIr^'џ=UKw0 f؎­?_ܫğ2q׌ғBO9jz5|^ Hq t۹=f g2i5^*>{BH_1tG 9?<Uy* U-[%hM­ԦH̾;Tpn,qf"VVinOX^giM0P#;:ȓw=omj(F\l!:xnđɀs&d$)TY;ܑ&'z2obXG1 dzںպKܗwO %m<{E=տC܎+55'}w5F,g4eY `O7%5@Y0ƞ =h#2W3~吸yO@0:IfF}0{WYٲw<[Lf7:*z ܘ6f ^~-^mo6s>r_H|^@WC(_؅/1׮j8@C"l(Q $4MǤ(HsC!i&Ml&d .^qOS372EY:@k]'&0 1sl{2+~a-޼73{ic[Oo9ԤC@o@ڀ Wnj­,QOט&lc9[qz4^h^Uc{ŘLPa"(iO**pS`QK:|,l )`zUp,j-ݶr&$d:b0F _6jɜfqݔK­f ! ,Ϛ w0˶0s7@ҿG ?grl Q`!O+Φ>fӷ?TEylNsF,l',6­% h/P2|Jcm=ADv>y/a­)n0 #Gmy?Ņ:~ּ:迉'JXeN,lqΪ*=Ƴ N n}M*sу6ouי{H Ȥ#/i5jRdQaJXU?2!_= 9E:-ԟƅd*Qe {5ģM (HںO4f&_[-y|95n!T )+慫x&L HqFԘu{d?3aۓՕӸ_/z}bV8fNY'd%WϿ2[A}y${FG/4$m8eTD:at$2\x)zUɥ,@%YwtXwDsrEzI ܉G& }ñX$Neڴ5rrtvۿ#]­j!eիo`v>c/)q⊒ɡ+<=$IS8y2SZo 8T] ʌdwW@?'_eN` I B>[,Gk5eAeўBe΁ x%|kG 9v+q!?yJu"tsrP>Ŀ;H@mlLn+L9g?=0 V>NE+oS*W;$Gem-*@ k8WE '敋wk{\٩E*NKA,CxNڟ1GLr},MkY7"[aD~^ٛ58@Q~!bAd;^c:m+$.꣢XJlJuyNLnS'1V­}jҕYehl:;u oM'U [ s'(M;{~jZj&B=P>ǏlP%1uӃ8w YՁj063oDY4xȬ'!Ivޕw2G8r̕}ASm[RS'<Aa'm҂.j7} G­0w93)4]lԉM!p )Í yz8h#W9c(۹}f wi)!*d5i]B<=lh\ֆ<} &cxጻ"Z12u'YJnT #Q"y)Lzfhwxt΃ّUMPo_>iEk66Gr$U'+T$čey.Z6\d߄0#IʾzLC O %כaцGВB2DZNl)cy 8\5ydJPu­ڃէ=TsM|'of]^y`<=­ т;@{D  7Im|W­>^ ;%t̛8(ָ F'k#i$+]%'yؙ| <1tEE  VQ銋ԶcBR-V^ Hxj;gV9­[4A}uG2UeO:0J0GŴqJ(G?Wi\T*$>ݪ~ ^>nMiJ1s8mZ p/PO4OJ870XBZͅ=FVnX^x̤ͱ:3Fo4} t9WD9Fљe.?!2ݽ r_ @}ߡy&­bY; ج0;#SxSn`6Xb:,6s$3\%`V`\dS1'#:i M (C$<ݱ,/V6Dr.e4\\ r?Hˏ0մR(yU1==DG R>rsQ6 D}md:rD.%kcUCl­@IsHڗ4zd3· Ń|M6${ u#d9&z"­\ W[U1x|)s㉷6/ KCMlpPY>y05y/u9^ib MWOW  8Ű(?XG>+r7h2h(!?HS8z ?][p6t#E(+v$lM`F +D}߽pz[)AX`g sXT_*yYmk^K"3ǃfd늩zOAY KzdEIk4QsMQ-ROV;6t_+?C'l0n;Sg{V?B i ڟdvgS91}CZy­hjMה,06:CI$)p PU^f@\c֐d}ܻ7\R49u(kjcݮ+`̲;c'u:(HUc!p=,CG= ee0 FO`N,)(s­1P vlc6j?P 7^f8%^  [  c­0Rn#ܻ1j>^NGR^'sfh zwʥK1( kjVܨV.Xj8ŌiĢxU4~?"Iܗ- F\Ǿ~Tx{&Jޡ ~"=%ʬ\-h`;$@#TňMG)cYFa%~S-7JYB.VXS!- stx`R cAP9`pk= қ/iӶsa0.W<1&~ϝ4qW/q#uvNE%L Z3\؄ v4-?d#Y(裮/xo$wPi~(@sxͅ>, 5ZJH|IF"Lönu;t Kpק$ _dm9|ĪU2=`ژ?S>W`23>T 3%rr%jMAwvl^w)7g\L0@­3қETg+hXZz }MuWP=p.$lk`rjODi,iRndnk#w?v@mH]DM W5$Qr,BIXA^+[TdGBxHw%1-jkL,rD؞P jzcvPög}$}Rc9rgPچ) f~vn~`=dpMـGq:=:v*\S? cpK 3v㡹㪥8MZfIϬA) 6_gG0|dz|3:edIֲ˚JG*݇!\{0f"w /8)|1h7p]c_uy ~ԜXJq0m1l[9xY@(\C~.^_GېC­;sjNM5TJԑY<ʩgFDlrVQGWU}8k.#!"HH\|rˌ-BǪM</bP]96k P)reG5­(O!m_78k@7Q5$w"m\~F vH޵Xrd|LEMu:4xnJa24hc9[eŤWN 3A.­㎟VEWc݉G­6=wg =kh;`) 3az ;5)x&5salֹ'8a 02p٢@Y+O~V+Pnr!2u9mTq+}#3<=nD#AUU}'BK'A|%ULf;G7*Zfin!h8wKqk},Fw Uzɽ' _텈F-5♓Ӟbn_oR(#'I}, Y xO e`~qdLN}h/@(6zJp'#L7њNYcZMNÒe^`x㦱{W_6y)KV +tW͂j_Mztj jc­.PgW 1m:DtW"U5<BihR~("mmQ|Q ЄP؈.R!8{N+ SUqg^&G­IGvdpr]NK=oeӶXtٵa^0x2Wx-i_ջi#skWKg|4kb+SFFBG~n ]b F2S'jz~}L`N m^^6:zٟ~=N*jBVRd3#~Ψ3`Y 5TшMJFVbkOAlͱ`#eׯMztF$nf+- *ՆQ$CR݃ #&vytw#-Qf5o$1rz\G/_)Y8+bFq6|Ӥr'oD:ɲ03Gv5 |\Ce LdiQ & t<Í\74u:6!)È rR$@t'eⰐ0ISl-? }DwCBаvY]:ZzH(d=#f$O"=tՍtUI~hFԀX +x[~c=L⌑y(YOrFQ|sfs=q[rKoS ]$~+EnL!ܓqHh}V$AC|!5:̘C],IÚu%Vm)8)F~Q+lyE`sHYPp~'n SJKGr wqF~(Ll5YIC@_qm 7ց "ǸAfRy@\ ť,`cdBE7+1jZ6­BƧkT­"rkK olH?d(jUjE0%­߮e^VlmY~&5D3+,+N RJdhmM_'\Zd88|;NzX o/( 8o1y3bog$Tw\?jAOIpߙZA- ,yA76 Eu}N۫cBi銑̆Zb|X >?>Q2B 掗d1LAs'q;<)`GFp!x~˜a$AqQk&X)RO"RYZnesFX z+Z,~V­= /=cl();af,8'D:b~8б#qZ{^\×\$"aqwM/Bkh~ d&scr(Ci|E>d潅J@5] WN|JcZVxCGt/浝N6 s ݴv E俌aA+gU8 х E3,4ds<]9=!!2 $ H!q=r E]]uրkeX3eVKrV*^ "a5zPgGO QE ;;GOS4?Ee =K.7ו\H)W?(z;)="2)̄2/×C5$1$'rhM'8X ?t?6­60tp\dUUVS뒟1@t/C%Ia^hH h`!%;/|SD)f Ґs~/#Z]Tcc ($P)-wr]W'!сƻN@Sd?H­B2gќZb$~DHl ? G %3i ʝZWl\ B}V?=ݙ5~<\J]}qNZ}ΏxOε'm>ז6pL3\rtpz~Ho9ۿJ4:qd"hN%Iz9hc/18ԎY":Q$Fc+[ނ ,O~m`­i@q6ꖎ@P#bNrg-skP$3/c(? "_o}3)vC~B@c.*ms:gX%"`DՇ}bu-D@\z1|FZulE,*rU]QxB*iXQg,c8$ok-;?%V=To.8@L.VIiE­+ *=ZbDтEpG1i4} ՔEI8`BXWud8 Fg+̸$* ݴ3 1m+ei;%\ʊi5 [qO7mU}.] D#e>gDjuItуK­_s&"CLs"ûax`=vcXH1:w­{C%n)FG0棉rr : Lpz~7f wrJg{0!dݟ/VH:DUrB:弻ay:]'C­uNZ6,Ϗd;zeҙȍՌ@ 0+F5A`Y˨:ã|v] cS$At@hCP)9і8 P{Ybw6  V1@_m}][?xЛ%z­_`)FAz u-mS'ٶbR66cWw\ `[!ϢDLMC#I&0`%󏆐n pgF^RJv. ׳H3YJX< fv ;XMǷtu~KP<ݜQAKᦶ$`95G)j3鶚 RⒻz;*M8ӯQB¬*+DOL"ozʫ5S&D)2N­Z"; ㋲ "E $IZ$22[}ͪ-EO:~ev8tbKˉxˎ3J>;(:}6 @O3Dj3.Fإ A7Fv}`3Eʛno.;.v#-`\ !'[PDS{X%,v'U#%RKYs9Y[:bEc_U $7cǂA4cq'q u]Hʩ ytv$eTin7b:bO¡2ϲ:*=r$J9I*Gp8Jo7*Q@iŸ [evNjY!ڑF5C5A[\'Ly)yY ߝ(`hnX_[k#Xr]Ӣ;@pjVudlل,L&H)=_((8 M07oju 'h W8Qy'$@\$d}thH{יDb%I­#F':ˌnEw3\x+UU­ r=w@gy0BBL AYG ∉yb8gBפ7m!RJ O<]1 '6%F  ֚~/FO߂ݯ} s -t:KQ\fr5ԨlCӓ~`s$Z 0.t6`"Vzu;h"CC4 fV+} Oɽm9V:ӄ:LV}ӟ Vn?^ hYy\qߏ4+0AT \IW ۙy.hC  1sF : r}0ͦF8w 8آG91ӡ@7Kk晗YF)'   X>f9}T0ENh[^kLz:TBj04]2S5WJ4sc,&EL¼fmG x΍+l-a5xN!D۷㮻;Az09m5#qi<y9[hmq>$beh_{9҇yWJ xs>THBdk񱉰"IKId C)1*\WY:Q0Rz07o> #6du4zJbEqR飅Ge0$2r$j억8GMԯ5Y­ {Ps_] =_V*F­cX?<~]P⋫T%.C)~GtgO( Ut˝Y$7fcR(⎝Wׇ24 ƙta2M-w<:8Q0|V"4:O"JQK8{m29gobP>E4ћrwX"E-L.,Ds6M-QgկI iO /b &_]%<2qX5Data Object 143  ` 2Z0`}.Mm@ WmContentszImage1[_Data Object 144 ` 2Z0`}.@ Wm@ Wm('_(PIC2d'_PC2Le((ʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f  ! P [P< C~ڟ5/ 0cO )3' W@״! u&h`2yAi\zVmmY­lHt DBJ85jaNbXνSJ­­ Ss5^[jǷ f4,8FQZlGXiؾȇ7 hqVϒ OF Dԫ0 ?z` v}b3þ]{Z|X,Xb!VO5{Fhy@W9@q6ޗϟou­J3 #,8&jb­y`/tQkm,­X:+=`{G_VbU>.obLzY7r;­6"G`Ą{|d^}R.%^Q?^d\9 >Ysm c [J`d(­83)^c_sS/46[­,}FسFYvg*{ vGPdFM|.lG_, v:}eP CjrNq16^p~Ӣ't;?i,Q6:Vx³%'I8ZedO;[A ^jHi8GF?o^)ֶC3!O01Vg9ZEh*cc@M(X{l>7 3w %j󀝰#+*4W3z`3~,j gJ}4­aʀzf u$ꙖTQoׂ Dx b2M`br7c. -vk\I_1êyn_mbjcYK4p z#WA2߶06~iT 38Zq2!!;6@@ 2>&#> Ohs_{ck[\^G06:܃FNgszSwX È3mWە #* v0‡4O]2 ж% ,­X^[8Җ'Gsl#CH,NJ4FM/7'g'HI|/zIQ0{?X&`GX[gN??jzH^泏O|:Ɨ E]ByRsD89 .$%& %J* i OՄgWb~<6B~ԯ}k9x?i"*AJ7(o`(ɽLZ P-­m>`_ 3ԓf; $E.=?|ʓ(~31\#Y8p@ w-x6[sJѲȡNPev6(x׊M6hX13@'౹yJ!6},I?aWaO G?ȰiE=)~Oy%{Ӳ718MpYF'5Zk 9lE#[` 4:尮q­MI t30(Z6F`LD X)=ägцAktJvw.o!(]Z+Ӵ%޾8WI7:lŨH ­\7Zue"}$tpɫZ?|BKD6i@Q=TD:`,s3`(;.i,&UU­/\(乚­R_Lg=i/F-WjH;Lk+w.7 GzutSb,i85'9]MV {0k UgtKcpH^_ B_~Ut{]ɮ[ ,}vY 5rEy@F{<;?kkE<p^y4 9Xh `B <[/i A7WbF݇\@D z,jd6"eBO@r!9K^:gjQ969GF, ^b|­Do-FfnQk2R`LՅ Qߕ;K,%A­"dv4ڳekE1 cf>PL]o!WDR'F,­ک.m'vEO26vs 7o \uUM86WZ"~5궐J[JA3w2r2:]IR?b=vʟ61dUvKqG Yڎ­AYS?sqőˊ_ -);c&A]\*irn_hoEj[!0/RM,A4M!2%[΋)/*n1{k-!}FçH4݈"d]EW ǺAouk2ł[:nN]@M@F H-Gj­%/GS"9&+B#-g,f)TDmxpɋ-DσqLULV"ַRC0OI3zՅ3)rJO2ZA#eO.>̯y#7)"Qw‘aˡ&sKs-)#ہd3'EF0{uC^7qnZ$Zv ?3vE|v,][lنqPƨ )_ٜJol?ch7!ѓn>C]xDN­xJP3)eo"Dٱ.8F2b$/3rd'h+~W염"~CY6oQF@cRPpd_,V;$[T!DDh Piѿ fQv 56A%q.w7qQ#0ԙ8 5Jbä'IMD[kffۆr=>ڝ[!HTigRHΨւrs+KG 2B]Ԯ{j<xht(͑Kj Bm9I@RDx,!?߁5:g49L<3+oq̈́1HMxm4~xfIDz!("`qm: 4}>&STA     DE !"#$%&'()*+,-./0123456789:;<=>?@ABCGFIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~l=Pdk-{f#UѺy>䉑eƇO*0d5b:')'lb} s̤8\A؜Ǭz^x3!Y#~ (QֶvM6rW.5lfhQܸCUUPT`XҨ/)$#s­L(nv])GL+ԫ~Ip ?Ekb&BS[B;~% W  )@Ҫ9Um/ k-#l ڒ.X@h%"ȫӾgk^IMl q%t~[݅mIPñ|L,44⑈ ^fm=K+_;7D1)\gԙ<͡<h&Wc x7=k AqbRVOtՙGxBb 7ǀ>"kZ{S> TJ$ʂeHNVgL{F9w Q# ?6m%a%"i2x$ sFwئ)zUa2~ZgQBq­&#,s9l% iw<㊶A>5fhtZ}5>cP z)ƳݣPM­7Wq_a ^ߔ,^[ q,_ÕH=D'j40Ӊz\<ɐ%mklƌhyi6PEz6_̬&8 Ϝr_7- ΐ>pW|OZSȡA4 ʫYRb׉˫2^q,w{,U;_2+6供0Zz&*~W fNW+Q=l_~pr`$Yks'[^E=JA7V|R/4 TgH.:;#Qungs4p7{!^@d;I{JS3q,e0AoE@XZBZlnϿt6 ZU1it~8X$)] _>7NؒL:W|Z24RVf%((H,=hׄSu$5f8V\d嵸 cۼ/ӁU.,߿tH4_eMA@*Ȑmza_P^'KaG< E]X KdfĶę>a){M+iщ!79`trV}~X_ Y A 7P$eef,*,@[SsL|d 7\ ׵t/%L}nO0F,yU6m \/9E↹Ct.p|\{Xt- \j@{&C0 \R)5bZTJz^IV]g:68XvhXVۿd h:W8PMpgT Ze N|),"Otn1՝R_ *?_("DG3,t0a Y#ķ*!u`޽x%ע(w"pT@|6=f5c ׫fBa7iDbP5':V]KAP{kˤ>M@Ct{"K `W,͆m&W}.AV­_ƹlUb$D]S@Qk۝Qvx>;b3Myj_+_>4|t@d BB+4eQJ76*0*­ 1a՛<"{<3wp:8W]g % <G5pqeKpdsV%Hs-=sUhr-jњ>\ G6|/ۀcHZ#B|5D!P#?*LhF3/uS4`{­FZ{w´s($!g@
t|6Sb׹ $ ,Q'2a} 7jS26>Oah?ȫm5V8 բIjEj@­X3(O@J_s(f[ɛkPe^_֯(@ӁuzzĉI@bv wM=w.A8@b)E[#LBiYn%o v. A99-RRAW{2:vVYD"rӓH;iF ,'NL2c) z1? #g -RXR$K?@* ֊p-1NDŗp- N! Kx{SV/bӉROƨDU'1uֿRIHy(kTHFE 0>ޜɳTW)}$>­0Ftϼr-K.J{SjQf3 9#\!ZRκ-G.@pq/;wxƻ #;:y-YX (b"MYE@7A>z5su:Pv ؤBQOG?^Z)$N[ROtlTѝ<E:L{En2 )C· uur؈^DTue 1:qt &4_>L2A3ݣɅ}!J0 ;T|UtH;пpё{v_;!4 ~#*3­:z\1t\AWK<-5W@XЮ52d.18;"YXQSj]ǏeAq^!- Y|TVaλZnqʐI>W,K)Yr9L1Mqe}3ѳD)Xq/DN,`Լ;b­ԳS˒ a2pza}TϜF9ܙBg(UWd­nGڃܿZjL[5bM}ȘsQ٬s|Lj r%?7~ 0yʿE@ݧikaX1S}3;yo:# !tNh ݴűgXld=WѬ­z6۬u',L<36I@%vCy^iRv@ *ZlvǾ!E1>Tq`0ᝉ\NGeh(gp1g3f ̿e)$:bi|k-oQIXv㝉 W?0TR  ǓݎCDp+SRKs]j_ܑnYxu,v?B{ JlH[K* 9pHb~%rUʾ <G*l9Q| dm5V^ VS9dF;vd=pB~{׸گJ1l,|qt Ƿ^uR'K2%l-Pg eM18Fl!  S2տތj2 ME~_3p @nsJPc/ Cԡrӈq%{d߶ QJuv"f\* 0LcOf.­o s/]K#E*Hҋ8!d]_)ٳ" :FFay.q׸cV6]9 u?Л5­@V­x g'NqS ٘7ZiK6I>S(}lb؍AO@q%"| (b_<}eAjS;z ](o'(G+;̆ㅣƇ)!80 5d XhJZcQa!ן(؊ ը{ yʽ6W­愅6'3?J߮Fpfn Wo2=\U#­y񵴑TR;s=J`\{6m,2qA__:Ga%e+KT'`TڄZLDu!,UE:*ꦜ­Ό%b`1]­G~7.)e3k$,߼4ӄ "s&۽|Fd~&@ 7{^@{lS70n$LnjZ)~_o R1( m*8l)%%V>+'hsp"@͢%wՎMP\Uj`nz4ss"{([ۥ*3fLǪr0 ;V.x@v#]ҐwkN h㶐 PڜJՅWG$+It.N _ ]4tQ?n&94ɪ?1#᷻Ⱦ{ƣDOC& 4|iA\#neɧV*|-zȆqoxjr f%ȂCaYy1TA/lF)ہc1.͛^ҖԼxP!VSOviP*2۔-eU7ͷ \PM}$ܻAZ{Žc61;xn؂­Slm|QmTB)1RqbWzqlB9Uׂ~^k2y כ4S{Tm]85{BØѓc^ 4\jGkcy2m{88o̱r〛)_"sZ|7wYGvuZiL,3$8} *bO'4u}9:`zcyn{8B[ &n Џ5(i0FMfq%S7qj"dԆyV^T^I׎Twð*'A~[CWpikl~xDq^[*ċWt\ɖ7'IԙO7X/Y1` `8NjvCQNkZ(JH­:QGM­ cye A 6d&1̞o! L =t kJ?t<@G58)4Zi37%c­ nGۂN2O&$\ rb&95xj?­#޺#9C3ZuAIÈ[ =e,Bl]F >Qlͻ+2ptDO<s "tNoAX (f)|7pfKbZD''{>_TH) #=#TZfq?W"JXh ?r\dN .e+_+ J%VM;J퇕>E :wD[ ]3s!13>Bi:1mO­p7C_lK)?h6YR^USY|6H #ACN,QuFxFVPɺ1ǚ­|,-\Nە7򬿱^*$rh­@}q`]9+8$s C(H ci­Z[hA\p>,hIJϤ8ZpIVv6u6d^Mc9昶 K,LIʾ 3­P>< ҒfUp\W0@(}ڢ_Ļ /:o6f=<­V➪'8Mձ-3)!_eӗx)hJ/{ qɶORrq̀}߈hyw 3¤?u?؊N73.6FD4ad9pN#&NG=lr4 鿻R jsV|lJmV|vu^KtNlh*CPlqFՍ6,ilz \)&m>iwuڣ,(:p k?EA:$ R0}r! BOU>_2K-K˨ ]Cu k_z&1x­Gtv !\G?7gL"j+q% ]})OLN&OR~#]#~43 Lh #>U:E,bWѝ+kz]yTYAY<ޔT]#RR|Apζb~37C0S*y%{6Rc. }]vnjhN1P UO|L~_ i_䇁MzDb0ǝ"J ?IxE>ftPN.{B Ζ}i{vxWazb'UU FTH"gpcN\9w)x)߲\p2=$1m_3ʜpkc+M%E; H #P~t-H߫{_Wjh}'Bp[}[ˇrD;BEn[-F.B hyƗ.{О.S>{%f6\WPՀK-G nOS!X23Ah &e8 R KG<2ٗ r] 'ƶ 1*_ȶ.z0|xA;:LjMiASl%icުgXZus*FCDnD$Pu)M4f&v?;MލPMx>o !78­ܮ|Ǭ0 `1(}4A:Rr+}L,!K95{+@,!uX*Q("Z~F$Xc[ˎ X)kˊs;9BO.!J-DcJ8oV@93lTbtkى mP9-Û拧e*4­tw;~6g}%k4!YA+r+l3&)X\ %q lʐ}f࡫%;A%^@YzjZ\$~ZvT&Fnݻ~CJM@d@qZ"<`yi/xŸ_V|n ޣc9WGwwhxD&~ͽ ]ъLӧt)HH"(wLN}ʻoæ~ǰ C(DOLMgn K$h߿47NrR@8ڏKf Cfz;``y=7G va#}OR`=Kllz8c-EWW@FKD%^}@sM"& (L2VYB@'j(>tػ0y.,Xٛ` ZwKv MinU[Pg6GYٙ6E];b[nQh$ָ8%QX_M@l;]r :(l<F(H 6S1pzb&ʹ掎[ _\]LOԙ~]O(s^Žw>./NP]hviO AY_Fs~4|]Pʆ{)lS>.'T*H 9NI2ĖD"ّ/WoDo; r&n+vv%-^UZJHfUKI2S](m`F9#0ΐ^Pڧ2ݳe_5Yn RcO_4t&dKa~W=rH@\" ߁v pbϻ:'­ <ŋFT|)xb/I&  #,Nhdf& 8P+{)n@wa׳q)tOa9/xܐU"ݹ Y>R:b~p75ڷ r:_M/:(} y{3Q^<Tus)H~­07B#oƔkf hd&.C%JV:>F7e[oUJپwXoS ­ DAoo(?QR2eK Ja DT閴 K[.#RECe_Z]X'ZmGU_=2m\V­,Ccs,<4g- / ov1nֺmŤkt4i+j4{]IY3#l$E0 " \7:A52, ,tX >EU]nˉ5:ji- 1H7:Z=^;4?::rLrUjQys]|=1IyP$?.zknk<٧AZl0>/Ħs8s L4gR*GZ;?@­x=Y?GniW,Wێ_0IbCY輋)0Ď"@]ߕTpFOR>j|O]F lkͶwVYU,Z|+WA9l+[m_ m%QRWdZPy­ųBUC 1dX`l :5 朷xmkQ­A" :ڀK|/gE~=L %~.mt|`%4" +ʘ^eS'JyKhS1Oypj L-_#iYM͈_E Y$0V28BA@o~K_+ ڶ_ƃ­c Tg­tGaՂw͐Bd f gW”[+ll!ƺu8^b<y޶מ<6C!QY^(\{[oi(RJ|u5%J<5 u,^= z+;4:% ^9Ii ,cTvyTo7?@ԋ`8t#_\ZY#4Ll  ^Hر u%:֢fب-\\ŋ}9'&Eo4hQQpޕgCrA/"7WDۊmPN潑.&L7~Vb(H9|pWIՙ[hGpZkQr@3m8~pr޹/]xXt;I*AsG]*^HFAF<*E\mht2(m)96SZlLff /Jɐ5 e}Տ2`d!j,b= ޘXP`|($uq^Ԣq`uj"Е t`CK <-N4 p$ $AB#LcCvSMcS_nhr;]8ף P aWd4N+ L*I%~Ӗ$vSUR$~­P\­fsdֻYD$t(O fcG65&a*mI V ' a?#8lei&3s_,­48!SEqD4~Z,yp )-k bxAl(.B) i­ ahM0R6pJkEub(8! ľm$@|DX0υB9}]-Ioΐp{,`ٵL~h J[ST S kx<<Đ~ҾҤbW+ 㦩{#r6ā^J~o¤aŁA$Gd OV?o,Q_/c[dӚ ˺9`v(sk n$ uj#Tme!m# N|WYMC݈q?Et#?yZ>2 D/mhx.imRRlbU-4ٗ 4l/ p{b)i^|<Y{5/oK.Zs`#'q,0ͪ?AA&XE|FOi­E)S)pMqv1{ ¿"~vXSςɣdm@)QtC܄mD<ՍNtnWh OYS(:&e6d|+Pzٞ ̊,A߄k[߹ߋJ:r ߵ>a!B/#O;_PCB$M ?ZG,VTXVXN-ԹI­&Į$J2`|(nt1S (H}۟=hԎ=^P  5JZ+VaqnR UgU#bx웍ؾܐNfY<­[L5LҮ ڛ5Zu0FS~ף4N7Edq$=.,EkjRrj=.--; e:e­9E-!+!E¬B_,fo­`Aӑ7Sg9dZ;B *tL{+-~ʇ3lDƅCQD:yM]^EuN2s qA;Аʤ=EO/G,s={$ɓ Wș~׎QK(1 LHlnhl^eno6 -9rf^]Z]ت~;i+($TMT; Z )TOmH=v056sOi޽R>>E,]p5|5Ep-}YEg#EoCtcإ8Wh@=T2䰙_f릵嗈IHj7hQ|?p۫RދHJS4Ď4$kOB­:8jZzGVx5?Qd?3qkl­B_Di&^:hoJn6{_h lj?J $);F bYVCOS&At*9R#N @a5Q/1YGbw1Z0z[HW-Rh1'1&[GJ2$[\}|vJ]bzN(oB肳yE\=6|N}/hx3i(3VVoP!1}$ˈd@uת^`kD9.,N*=$ ZۆƁA"j`FKacsA\blD@+=}BnK^"0D鉰 L!k)bAHI45HnRj^}MsT6.- x?Bj'*FIM^DPPі0 ز Wp5ouh0*&嬜:cG)vqON'7nT@ u,v!\M6 l. gtݽRI͢lh,̱ saHT '??,D≹n3ʚ=ADb[<=ijZwls8ϋ;Յ_]Vԛ ["eUWyYCU)}-*ΎsGr|kRj` 5E߮W*Vܮ@fP#I)Hzb8Or'tzMpF-ld+GQĂbqp4GLgO>|J܁Sm#)8Fsط [%V 3żOܑ)bz楒{Dwa9T­2u%:m{NJ~g ۧb884@7',Yȼ3K)V4qFXZT3jg1-05d jPI.jmYގ_{A.jp]eN$q @c)[}Qeh@Gީ:D6C%슙Ⱥ^qM"TQ|. <1^8š(Wi6N]3N]ytlhw>ͽ6/Cu]-$j k99;kŊx_֎u6\&;'iI~%AjKך%s Cks%𜴼9­,U ~s'6 6]F?eIUnwXTD(qh13QV^g GXA& oCIf0nj1ۖШsib鷃'/zҺZ= ezkFMәCQצc%.PХOL)EB(u</­I1;Fsx1rD޽s_# =!4ghklg5­.0=B­˘g0z Q"ڂ~Xݻ­qGh/u/z]{M0=;vZ)Q2kN包ul$ ES|nm5xB;[RտɊ̝,6t!.J{maٞx@t<f B)̥CL5<1p-ʷ#Z}DQ@/~<=Wd !JK±2KVYܝʜ3sT.4vʛG8~ y{$d||Q5 DL's8B{b2Q/=u{O I>Ge dEPT'"r]ulъ^K. {KAlPN Sk5T› ڢy{aXT1#82YE3oyB!)ܺ2X?U:irz%n XMY23D~?bgݻ9&.GcS-&Qؕ~3%dQm(\ (yHv6DȸoQ?H yz4?:`{l}H)]T/Y1wa͘T4 hrWdq&nS=1xZ\X\E 0i L^5Mو­ɿ>,Z9] )`HIh4#:.#wlR Ӥ$W,.v :xImage1"ContentsData Object 145 ` 2Z0`}.@ Wm@ WmImage1"CDataObjectRef FF\ Embedding 3F\Data Object 143V +``4qu>aH6?CDataObjectRef FF\ Embedding 3F\Data Object 141V +``ContentsData Object 146 ` 2Z0`}.@ Wm`^mContents!zImage1 T`JV +``XImage pasted from clipboard. ܤ;?_5?CDataObjectRef FF\ Embedding 3F\Data Object 146V +``@`(S(@PIC2dSPC2Le((@ʦ3f333f3333f3ffffff3f̙3f̙3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f̙333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff̙"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f  ! P lPS3F3Gv; g: @">T}{OH_j6^Čxjj(Ԏm|s.6K`NU­&*Z>KŔCa,:JXt} (K7zg/%\2̜Ewb.j­wiJb[|6MAxKd@J<W0coxZv5­_~97QGpk\9;LZ2$T&|hMP,K %'lJ1{19]sT)RU .mZ<3HZwWFx߰Bm5] mZy(?% kH>ZGʓy1u=۪,wN* QXxG- `jWl΄K܊ڵS;w#7g9W7Qwv-'tbw _Y`Bb/ -?mr~x͢]|[4L2ɸ/rۛX*%m#6Gg70L+SXY}Ԕ F^{@7Ug?j ,뫰i orrw:NL*VE'yPeŵM̚Y9;]G>Y$mjOE^~?!$FQ_Q=LʆNJ*,%K~ mX,b  aɱhL̄ttE(He!`1iBz#GBtEV+e9,­ QnK=g4dࢹq$Wn(­@h* jH]ar 7!)swp?$ !힮 o<J 4jF3.­%8htٲU'{bF Cy'{NBb <i^r\hw\o waKGW}u۱Y I=hn;0F %m kG2 kϽ`L=œft7O׊?cdu&V}h}nN WfI6pZ<P/@fH?W"Z 8};hw9M̚gU%y ץnnSf_[_sa_>\S)̹8]btӖ|:fDX]p?  {.NjOM~%+P#_ p)w uƀ%z,a&m,4+b\ښ!?px^ g 梁ER GвgHIƞXQ=ەWy9CoSzܖ.6<<`x$c]jfMA/o=^5?UW9g8 +VoW]ۓB>왡4 ­0!Ԝx{|Te0'K r+­;w]t{ M'cY"ibrܔ^l- ]7Oծ棽­O X"b5­/M1^W@GHv:싲ߩh@r:o ­@:Z!J\r0iH`nд&淮LiDKW]9՜`|]83­nPdnޑ,7z T8$ QLzch_M4Ps~5 |UiJYJ ;Ӑ*ݢU޾:lYPx]fe!+o 4#qʾAzA`oˊ4Ĩ"_k-K.'0`_<;;p^d9J(DLQ7}#χA deH2U yYQkY6Vt&"v좐3R~x^'|Q+4/O9}& yc#&ƊIy۹ ,RA \ h,Jx%'⎬D @9V<,Z78{:U­Q] ,7V$H/&0@ȫ]:rC3c;!9@.-5 ##G8AԬIީj. *Z4HgMv%Yt'"7kj/I/0sUIreSb$-1v *M&FcB1 s=%}OOF-DqG/} e*)z1a?w"a5!.8.?1ow4v &.0&09x#9I0lRVjD; 8A&Jb Fmq=.u?ZT#X>o_9bnA2­GXYIwVC|UyY<2>4`Nnq+be-/3%2 |\\n?axkBJ`\VdvviK6`4zV/%\B[Kgg܌-+3Lpc<9fu 4­ω)$M#7{}l"!c0 I5%pԍXT=cW6Yzw[$_`a>fz7 P.ʏͧH(xS=oEz%[`Ra+pƹ٣ab+4 o4kux,[{4LHxn!~jPgkZrmNxɢt֫i+ h(J^X2٧ơ-= wi'F=| `6'7և47yG""ǰHwlKނ%o4NŷplN[O1T^0{7 3gdHN?,!ZV$1f0Ɲ{ON]jxV­AqŕNsgf#@Ļ;,r>G  a*fB_g,ҧ$P7| _Tef.@º- d{=dSdc{׿FINq7oJ/>! }oDO߸s%W*e?Go&ڋ tr2Y Fme8_vUg~?Awk,'_%jc;#&U40BWn"e,k<)mĊѢbc VPO_Ee_2'iGJ$7o.{2@"3R(UX E}s, 5 r N߄}%Q yuCܻC?k/$(ERn<_>^  QQh @o ˾o:$ݍswA/RDÌO]ZH 0 OOafv \=n+:k:j;/J''^"Lho3(v5$- }M h 1Zo SYNY;@}w:P:b8rx~AF?ވ){p5cy &H8T3ї bP, PO6'#s@GLd.e0^ɹp2yy[Rzw4Ź,ho1{ T YR]'i4Y,d`.4Y=⋺ `nRX]D6ㆽ2VM;?~C9­Yk܇~%48@v[ }JHGOOa^D mb7:]\_69 a9T{t2*XbuU{d6p">fo?JϪ XY[ęR"dI oe`_-=eOۋVOJ7Q!ru`W {c@+ʪ& EvUas62J1P ?wo!;8n !$ՏV; Jc6 Vx\A**1րCeIZ'&d?1 i@AjJ)2y遲փpN8L (sbZէ V­Aү!Ľfq͔7~G#\`y6]Xţ f[4yQK^@T-_ s^tN uuQ a^HcP1: ,Oِi8y.Sjp3[,̺6"1Rʢp~­)>ܷG[Bg]Jəv3 VaXo.vNX ?C@/u滝v${qJ-96s [ǥUj (rʍW";o ɧ\e… A nw  B3LEQIk͓Uj^~p~9Vxnp^:}7/*fMn 66 aNR<Bzz9Ds yWm_%/ 0msT!3C@5kB9KoH23W{(YZ@s EubRab "@/Q @Η[(Q[zڏ0O*Km R:n¤\9⼥DH|+_1$w=TPt5;9TWI/b"Z2;i{26|_jpӣr`whp'2 Pn~\{ݕr@֒$;"­J8­m5rPKhLuΜ(hacǟwk3~Jvc V8:  ,U(R g>V:6dbXt=NpLJⶻb}@S?F. \F^ƱC3hrbJN,mtKBՔ=r#Jw6 #Wgo~0PO:ᅦ-u*]Z̉d`&@.<o"9WBX+}jkp@n T%ls~,d$P ?Y'>$ X E,qٚeҐM G-| jI/o,g`drsv^WƵ)p(r~c:C>KEo:r2eUZ`kPEU|[E:+ؼmwBt>w]h}͑Υ'zPLD8x`v&.'~n T: =i+颶ϳu­B*,cqt\iS3ӥ@O\D]؞2 fcb`RT_^2ыTZ`=}NSxV9@m+j­;->o-?r9y݉\ʫx|vE {lrl{ ,v"iٵ_L.VfQݓ> ) 4$w2_s҇}ݫd}X ­Xɚ*.{={]'E&739zYU4{F^0h7²/B/C,#ō&b­?iq0 ,=5uThAoZ U{0lT1hM 嬂} =.8hroUȪug=:\nGN1WډǕ-ZGf0T>=* bvU9Nb }W Iƛ]aS/?RpcR1xzY+jc­\ILiA Ll KNw5tvtoHr{~CU8^pS|-R[3;X glvO7T.cZX.ձ~!0&Ǯ:~H Khd*RVG1­ 1*ҫT_"­6GM _`BDZ'Q)2lozn-KOЍ~TwoN$Y >+X3ʨX`|c&ZHGOkRD?L h\%;~jsm`,-­_7 dFU]t7`!A%Y:o>­,+BBc4AKzTI9S)Q3_+,Nq\]x&ֶ(?D) m!Z)??Afm"sb^)V ҕ2e#d<Kn]dJ f?JqƑoMJ`Ƽw |\760QG`~C( ­tT,<;~]Iy\ qۅvOY_Vvx#:9k (wIY[yWyHelhgL97`PN6Bg? 6­ ᑴn=pZЍ '­?J`׋;*.Ɯ !zTLjnL@6 Ϭ0ɔnKw" {eGۼMKcyMςA"d|=%k G)ڂcXJ+HJ\YZv3$&}M Jy~xu:*eOϞDaa|b#ϓvZN#Z!lCcTeg'>ݷ:4` xΉ[aT0ݓҽ?vt\<se\B*os{_ĩ3W@}_me$ !y1k7ar2  ΋jV̽ ­XČ0sm=CqCq<ʌX`o΃_{=h P'EקuFM"P nȗrڧi׽7fئLd{搔xi.5њXԘ{`Z 3ωVKQwUY ;1F9sD'јB+T ]ʽ_z"4ݣ$0rxt-euD1[CrgElZe&M--`(Z1oA|xg]wh|@Y}]鯱}G"O/]تK^qaHDG|πNLjMs az(T rT ϔxH}f TPb zpΆ9Q^! KOZ$!f 磣%(/t&}\4xgΖNpsg̀g`D/J5]8DPb)­kXiVm_Oh+&8hh~Y|9hNzfu/Y:¹_Nn/ Yyxp^;VcFTdR>])E鮥_u۸`_VD~BPرJ:If5|;Nuffoz4u;XYM֫1 D>tBi H o;?%D $­xOTҤz|zVƌ:3|z`k|ԗ.\P5:%{Ԕj@l~l!XPuv6+зfnKsrhՓS2sy$-%ez"uIɀsI>vߙ {v)4j*Wg!=cT'*oҷGb/M0#9]K?%F ճ 1u(]lHR@/1lƮa\"YQP_/ ɩ4c>8p8#1L+O @ԈџV?i!}j*g3[j-o_pA{#F0M ]3\Ij7p9ʬ M"(s X\.=Ԗ<PZ"uu.@8JS(ȚyaK=ddg= yGiv:o.+E2<\⵶\A6JJkYWupJ_iETeh=wp!`'z>qʖ+랔ѐp%*#z|gZDXH oOb70^$+YOj /4gZ꿽u`DM8YyA޹) r'hʋ*9:VekMbN*o55NoKYF%ӫ!rziL^Fl8'L?B*¸ӄ^Q6/+j{sit(Tw\;"tcE}a ,Qgk]g;_ 35Ta{ saKEh)W1K|akLK53nmE(`:psn=ՑKƄH[/GPV褺TaǑ'­\Fa/ Sh2:mVpD&V*Ʀbq"зmS-K-vqJSIoE[ 8BGO:tat*Na$ߊ]Ek8e`o])yP\z|܍(5ķh}Ty\NJ+k=eRͳYw!&&x^H! ^,?4P M90*4_qԉ( |={.bV8cQ4xWl­")ڪr"llc@˝$aR)­Rc갼Q­,<zN];RXq&-o)B=ߕ'/='+Sn5k4o۬~~$OL]tb%1MCm G)8;ccdl$xO<^t9YIBE.%g 1V 8XY]8Dͺޖf[#`!̻z$C?~Xt3Քג?~=%h,W ,ʍ@̥*pva! EmyBAg}r],=|h%%'zX2ˈH b9`hO^c ۹y~L4­";Ua-ODi3婓Y 2w呿$Fy!d~X44-qpA J2:flЋ][{ 6 v-x"nObc|~nz`w'&)I0%k({dF>G0M-*JS\iPa ! +2C6jCy6TCbі+Y WwRPMSʂQqO/xz]kRM@ \'猋"#3Fj#dQ%W{﹵뙛S'Êh2B伪:+(`vXަH[Ou<Uzs VJUhge,,x)o{-J6eB=` 0r^-9|{DV¾ULfsV+XQsPlK-3~*\ȔanIDӾjF.l*Td7kG )?nnyF\r53qa}A-<'s>"5/M>\Mĥ64 ,]3-G1 ey| mvV7Ww8sj#vOڧGBG?^Ak­ɏk") -2mW K`4~O.BBLO` } QE RXEk/>Qߺ]nF؉\>(=wz Y{ 4<oNE95Nԑ6.vF~f<!b \UkіJG[5G=6ȥ9Ψ >>/kdMJ$_= Ѭ\F$C" WBhkcJt!A|(? ~͙1t *xIGm_HO头,]e f~6%+"PBzY q&{,CTe W n͝v?7'(,mXɔ5R-6 }#Ւ)@bT 0/azX`=` 6_ng`+5}EI9i_Ff(W&#MXc1Ήa~M'8<yb5*&sS)׉0Pـb􇌳}#Am-N8.|) 0`+Je*x­ 1M|16 \լ­ZJrjDryu μgIqúۢԻ,5­"c(L/jQxggRHFنԳE =$ 25_ &_o {VZe" JyU!k}a.)g&/Ǻ@ϧlvv`X\Ec-rvUKȺus"ٰ&U 1EetH :YFc;.#>tl w| xC$nR|{+z]"C}pQfe"U3{ Kru?52]d2Ng[>0犕z[(O[uk(OS-`I:6]zc%)gY= 7IH]}I eQ]$7PoV+QM-s%#uHZұ˖'Z+f_nStFxGlP빕WƙlG w`O9#ۣq:XHw/2 C#CKlD.~Pp|F3]łUB'e ^gI| ­N7J9ΎItˀ; S Drݐ9TUi7+ysA(0K,%тxt,z؂ r"6-E 1F#.6Zp 6sL[}{­Ȃ[sSӫ AK 620DW2͋GL@ͫ ^Ip2<mApp"(MQV+ lM^C_)L Һ5<9UC@ݒٮGvTyԻ,bIc̾6zb*vΒn0 %PmMQ0`BT#SlV-`7YH_&L9쪮٢߸Ț яP׽S}kp( eu­YѰp,{?2-=|tmɰ! O&,- w/Ε_@q/vV`Js;[TFEYE,qw@ Fiȏwh ch=(x/zmu! MKDf)b:EXyJD iAc9ظaiU NчXg#X- f&/U׶`#=ld I# .fA%*ށ~1xc,p<_4%1B"ߗ '\<J[wHoT5i2@K,Po *3@BL@LLxyvth<%). /=2DJ *­' stČOpp4A&UҲً:z?Z* FZ#!-c`_C̲QzF:JA!F(@>~y4W|_hZ=k ?08J^C:%{Q5  \k0nQ[ `q ou6l~­>b/<?I&4_k;q>i݊o)dTc <EEFSpwedHv q&[0 o| ZyLjs"=PJVl9'P35m4%<%vI& rwyҮ1E\ymIzڹ&vr qBhSL{K7Z_#p]+1*[uԷY`lw@D3<vw'Jxf&(-=­P\J_ *<X̀HӰRK0MlV͖0 # 5G_"-צ#.D(j=By|UM~5.ۯ0Q@S/el Dz8fla}>>m| Ӕ6о UTQG7Ol5\[{R94Hf3d/vD:3.]n*LX*]- R^<ɂ3H.A6 - oWֱ֘ۍ :ABPUi"![,`:&W.5gbڎcY*;,f%w  1z*YsŔZ=y}`.Hn;5F-&JAwYoMq 7 w1J2uc(߮TotMû㷀;Ŭc40_EkF[7h=fyHz}82`lL:ٸ]<;JHŵlfzpdpTч 0Im5'z=zCSKH"ҸSXD 1HdԣqC(`ʵ:EPK^I:AJH/I%޴ewFe" $ަEsԞm#)!uȽRXfFXJt +"6|q!' X< Jy4KU~,rkvL{.~z2\ub:m ;oXom`Y(ajHE xXDO*4/̒_B|Fw0v2K]qփSc:4**昳K'tIM \ q1SSLh.WgZ'Cq 4&N 6\NTq )RXbV݂4cÉ 5j̰f(C-q=)LbYЬMR­ XZ/(@/ȮHfK(k(BdBC­Wn3I5d K>731hG&{9"~3ܾkט4TS'e5]3󄿆4F9xi![T^ה`ѝz\B( ­hG  HH#2°nXt06BF Io }WpnOl͡@B52 ͆*4X fTy`Qڑw~ BU`b~-G{k@/FRAܨO]+=["9$yO $­wpS1] (#]MrLq­+1%{EfZi .&s49i5:h0h0a@n;3[n9F+9^ R]rnnT*X>!E0 ,`7#q@(L:9c˄0:Lp=;C QqX &>e \R~=1sN؉ `scn,$p1Hڵ}<$C!͵gUTmǗULvf /2dؘ&[^rI%zCQ}(y:ٻ;ÙĚ T5taL2tF­) T?i!pb#t'­H9ZϽBh`e﷌?$8xLV!0U:d1v]`b{Xq­ ^ 8aGtTEc>(o~[nh7'z95bT~i pl)hN,3EɬXE׏kLJ/Y)Aj_dI~ōW'GD}RxsVKbZeI 6GsJ(RbQkw 0Y:ˮ-l77I )ƔF‰95v) VL!Gl^X95H{ʡ]}KB h(ACvgߒ"|莆wGwxC ~\a|7 R\06UIi>Q<0Nkvc?,e_VzLM^|TLN 2+G.<$\:vЇZ6LTj<^ўvRz`I XB=0URD "յțL, @O!:<), U&,"r9?CDI&] 9WK]91K &][L(W Rؼ| YСxA) BԣD2m,J++9Ƀ_A+v<EDnwiIxbb&%Ȱq@˼7`-Hr8ABG9Mh<8خ7C_؊vf8q0>NuŨkB ͺ$ʸvz­H]H,Nfg0uXCbWV7Ts`~f <'3ф)mk~^F yG)B6{s|<.9_B>(GGH0nB_U"n| 9^6{:tMy/e+C>?IdT=;vݤeخ:=k<˫¼BSI{lU[053,/5[oP43S0ln͕dڪRt0?k.OM%~?j&خU4 vw,"\h3C {B4*doޱ/$ 8TH] X\z=z Rvx@{}=>B?jڬ޸*qv&3ڡT*#"R2y%Lz`:[KI:CXϝEpeZ'h{!X<G\[w{.­<׬-Z'{>°"I 2 #Xv3nu­.ܓCQ+T}32ʋ`p'rp{4Tr9PF­P^h=2bu .`33ad#K|,nz(JZL\0ߖi9a(܁܅ TQymYAY&/I>`3sgڥ#]Au$ݰ,NֶO?CuPbDL­h}Zϓ ?zp|iw­-<j QX<YcPmuTķ_|f22 i,bbK\^kg`;Y­{-tSxo cލW ݑ}Fq^`g?b`>hIy؟{PAXSST1 ݵ\DM2֕uRŃ8]#rM^3;!qYhJvPb 7B! :6ZMƾ8[\On :y6cUy&KEU_]qL;,v2+[j1­+=גl;59 R]*\ ݛT)_ ۑ,u%ܯ:㲢H{ @ eZŎ^ϽSAݲ1.a>6GcY$$3t­v!pbwl $CH%Hkp)x\CvqMy Q21xԧS g|h . )ӯ{=;oOM2lX %t.[3Gȡ%Ș3r1_ɝjx և҃l3@oe*7E$QQ#n-@j*4­vD#Yd~gkxgLsF<6K2Ȋ<+1\xsP Q 3l>џ)~' 9wZ!B:M"C9DǙ0Ux{Sʝbwq(ݚچGuvr5y7R-YDS;#, Nz&ehl^zY _J ph?/NEJ#‘m=HT,P6BC3~@+ :{ :ᫍH\]]w Ak(dW gP. 'od/7a=txŕ6cqIY4aR➦^fEss1$PBqs-V^k$(uo?XXoݺ3wNJaq!Bxf? m]5J3#F Ē%( ѓ?B$]4+z[T_بJ! ^łvh)/wv%*OϾ.8­ԄhL">+.H=v-C9 fSmbF75PU4ڨqr8rQ[M"HqWM*R lm;K Ri:JFY^)_rFGv| $r#0o~Mu$59M24,0h| jq-yF=r3#iF`5}ȩFo;K0mYuߛg5 /^L*@7Mʈ­2W.4&XV z5h}·@/gi%GM u2>mA4wjśll7uKUi]\ctO_% PkSCmT Zh  .l񳇚:7]s*Q%~:hAb+q 7KȖ' љmߋ6­ҥJ2@08z9Gq#IDI2s+/I ]ݐR&/­ ZbT欘 Q9IBڰrix(;'cBr$$rpz %teGN{ " >"Ak4[@y823FكKi daռ{-GA@-L6X@S+ 1ΟLlQ(z+$J #:.NV;@c5z8}bJQq8GBF `u;­Ov;pDGZ?){vM ǏYp%>Ф@~e`JkdM|m3)T^ eO{򰐳[Z_عɲ]h0 ڧVp[`(p t[BpfMTjLB氥43k‰龑[`]­ykw<B|9<tяP.Wda,3c Ge'h`<%@ ~X >|dF*OTtTR j)faDr˶e4R sCteЏqƂ0k+=ń.A%P0p,C+q/8H:/M}`XH۰5ޱr#rI%ύ6WˮN #겉:Mw!*Ǹn}ZD (]he/"4l+T85H3aGUs^'  hr@xt!{­OС'sLkxЉ%@PS`$/دFȄWǪǦ)IڼIwHîS" 2=SJZ 9!vS9  = 2?$u갤tNl <­}7r'nw) oM4F[$3 Jqd>H(DIf 8{ },֣RԇbLXćFxTCplxHeOi1f\Z`G@ߤ 0qSsל}î!ᐄc~2\=znmJ$"xC< )ݥS>^fǧ|Eɹ%YuYx0:8="Ý7)QY=՜tN ­^Tr@@Ӄ­-#+vmO5C;7*:vs;Ng9CaY;/$MyQB™;ߓ 9d 8ދtk"BHr3CTrGïa6-^=c s33U!l,fGbkHp­:{SK)na6摤8EQ #]A* 9OFg>FYfml%48[ ­WΔ٢'{G`|PPA@5YQ +B3oEe0e V"DZjtdebd3g`#࿀1E0؄ !p.֗60- ­JData Object 147 %` 2Z0`}.`^m`^mImage1#"Contents$Embedding 4  2Z0`}.`^m`^mCDataObjectClient?bijklmnopqr0,,Tripod,,,0,,1,#8TemplateDLL="TlxWebWiz.dll" TemplateCLSID="{31FB8C44-2F24-11D3-8097-005004ABE52B}" TEnabled="N" V +F\DORefProxy 93ContentsH؏ExtensionParams #@eData Object 152 ` 2Z0`}.@ZvMljIspPubParams$2 V +ArialSymbolTimes New Roman WingdingsArial AlternativeBlackadder ITCCentury Gothic Courier NewVerdana Trebuchet MSTahomaArial Alternative Symbol Arial Black Book AntiquaLucida Handwriting Humanst521 BT;;(default);;Left;;;;;;(default);;Top;;;;;;(default);;Right;;;;;;(default);;Bottom;;;;;;(default);;Middle;;;; Heading 1 Heading 2 Heading 3Bulleted List 1Bulleted List 2TextTitle - Presentation PageBorder Light TextBorder Dark TextTitle - Home/Main PageTitle - Detail PageText - IndentedTitle - Text PagePresentation Bulleted List 1Presentation Bulleted List 2Presentation TextTitle - Title Page;;(default);;Left;;Text;;;;(default);;Top;;Text;;;;(default);;Right;;Text;;;;(default);;Bottom;;Text;;;;(default);;Middle;;Text;;;;(default);;Left;;Home/Main;;;;(default);;Top;;Home/Main;;;;(default);;Right;;Home/Main;; ;;(default);;Bottom;;Home/Main;; ;;(default);;Middle;;Home/Main;;;;(default);;Left;;Detail;;;;(default);;Top;;Detail;;;;(default);;Right;;Detail;;;;(default);;Bottom;;Detail;;;;(default);;Middle;;Detail;;;;(default);;Left;;Title;;;;(default);;Top;;Title;;;;(default);;Right;;Title;;;;(default);;Bottom;;Title;;;;(default);;Middle;;Title;;!;;(default);;Left;;Presentation;; ;;(default);;Top;;Presentation;;";;(default);;Right;;Presentation;;#;;(default);;Bottom;;Presentation;;#;;(default);;Middle;;Presentation;;#;;(default);;Left;;Container Page;;";;(default);;Top;;Container Page;;$;;(default);;Right;;Container Page;;%;;(default);;Bottom;;Container Page;;%;;(default);;Middle;;Container Page;;$;;(default);;Left;;Container Pagge;;#;;(default);;Top;;Container Pagge;;%;;(default);;Right;;Container Pagge;;&;;(default);;Bottom;;Container Pagge;;&;;(default);;Middle;;Container Pagge;;;;(default);;Left;;Home;;;;(default);;Top;;Home;;;;(default);;Right;;Home;;;;(default);;Bottom;;Home;;;;(default);;Middle;;Home;;Site Name - large";;(default);;Left;;No Navigation;;!;;(default);;Top;;No Navigation;;#;;(default);;Right;;No Navigation;;$;;(default);;Bottom;;No Navigation;;$;;(default);;Middle;;No Navigation;;%;;(default);;Left;;Detail with List;;$;;(default);;Top;;Detail with List;;&;;(default);;Right;;Detail with List;;';;(default);;Bottom;;Detail with List;;';;(default);;Middle;;Detail with List;;';;(default);;Left;;Detail with Arrows;;&;;(default);;Top;;Detail with Arrows;;(;;(default);;Right;;Detail with Arrows;;);;(default);;Bottom;;Detail with Arrows;;);;(default);;Middle;;Detail with Arrows;;Site Name - smallNormalTitle Bulleted List,;;(default);;Left;;Text - Arrow Navigation;;+;;(default);;Top;;Text - Arrow Navigation;;-;;(default);;Right;;Text - Arrow Navigation;;.;;(default);;Bottom;;Text - Arrow Navigation;;.;;(default);;Middle;;Text - Arrow Navigation;;);;(default);;Left;;Text - No Navigation;;(;;(default);;Top;;Text - No Navigation;;*;;(default);;Right;;Text - No Navigation;;+;;(default);;Bottom;;Text - No Navigation;;+;;(default);;Middle;;Text - No Navigation;;.;;(default);;Left;;Detail - Arrow Navigation;;-;;(default);;Top;;Detail - Arrow Navigation;;/;;(default);;Right;;Detail - Arrow Navigation;;0;;(default);;Bottom;;Detail - Arrow Navigation;;0;;(default);;Middle;;Detail - Arrow Navigation;;.;;(default);;Left;;Detail - Title Navigation;;-;;(default);;Top;;Detail - Title Navigation;;/;;(default);;Right;;Detail - Title Navigation;;0;;(default);;Bottom;;Detail - Title Navigation;;0;;(default);;Middle;;Detail - Title Navigation;;';;(default);;Left;;Detail with List 2;;&;;(default);;Top;;Detail with List 2;;(;;(default);;Right;;Detail with List 2;;);;(default);;Bottom;;Detail with List 2;;);;(default);;Middle;;Detail with List 2;;);;(default);;Left;;Detail with Arrows 2;;(;;(default);;Top;;Detail with Arrows 2;;*;;(default);;Right;;Detail with Arrows 2;;+;;(default);;Bottom;;Detail with Arrows 2;;+;;(default);;Middle;;Detail with Arrows 2;;,;;(default);;Left;;Text - Title Navigation;;+;;(default);;Top;;Text - Title Navigation;;-;;(default);;Right;;Text - Title Navigation;;.;;(default);;Bottom;;Text - Title Navigation;;.;;(default);;Middle;;Text - Title Navigation;;';;(default);;Left;;Detail - Arrow Nav;;&;;(default);;Top;;Detail - Arrow Nav;;(;;(default);;Right;;Detail - Arrow Nav;;);;(default);;Bottom;;Detail - Arrow Nav;;);;(default);;Middle;;Detail - Arrow Nav;;;;(default);;Title;;Text page;;%;;(default);;Short Title;;Text page;;!;;(default);;Summary;;Text page;;;;(default);;Title;;;;;;(default);;Short Title;;;;;;(default);;Summary;;;;;;(default);;Left;;Text page;;;;(default);;Top;;Text page;;;;(default);;Right;;Text page;; ;;(default);;Bottom;;Text page;; ;;(default);;Middle;;Text page;; ;;(default);;Title;;Title page;;&;;(default);;Short Title;;Title page;;";;(default);;Summary;;Title page;;;;(default);;Left;;Title page;;;;(default);;Top;;Title page;; ;;(default);;Right;;Title page;;!;;(default);;Bottom;;Title page;;!;;(default);;Middle;;Title page;;$;;(default);;Left;;Text - 1 Border;;#;;(default);;Top;;Text - 1 Border;;%;;(default);;Right;;Text - 1 Border;;&;;(default);;Bottom;;Text - 1 Border;;&;;(default);;Middle;;Text - 1 Border;;%;;(default);;Left;;Text - 2 Borders;;$;;(default);;Top;;Text - 2 Borders;;&;;(default);;Right;;Text - 2 Borders;;';;(default);;Bottom;;Text - 2 Borders;;';;(default);;Middle;;Text - 2 Borders;;%;;(default);;Left;;Text - 3 Borders;;$;;(default);;Top;;Text - 3 Borders;;&;;(default);;Right;;Text - 3 Borders;;';;(default);;Bottom;;Text - 3 Borders;;';;(default);;Middle;;Text - 3 Borders;;%;;(default);;Left;;Text - 4 Borders;;$;;(default);;Top;;Text - 4 Borders;;&;;(default);;Right;;Text - 4 Borders;;';;(default);;Bottom;;Text - 4 Borders;;';;(default);;Middle;;Text - 4 Borders;;&;;(default);;Left;;Text - No Borders;;%;;(default);;Top;;Text - No Borders;;';;(default);;Right;;Text - No Borders;;(;;(default);;Bottom;;Text - No Borders;;(;;(default);;Middle;;Text - No Borders;; ;;(default);;Left;;Detail Text;;;;(default);;Top;;Detail Text;;!;;(default);;Right;;Detail Text;;";;(default);;Bottom;;Detail Text;;";;(default);;Middle;;Detail Text;; ;;(default);;Left;;Large Chart;;;;(default);;Top;;Large Chart;;!;;(default);;Right;;Large Chart;;";;(default);;Bottom;;Large Chart;;";;(default);;Middle;;Large Chart;;,;;(default);;Left;;Presentation - 1 Border;;+;;(default);;Top;;Presentation - 1 Border;;-;;(default);;Right;;Presentation - 1 Border;;.;;(default);;Bottom;;Presentation - 1 Border;;.;;(default);;Middle;;Presentation - 1 Border;;-;;(default);;Left;;Presentation - 2 Borders;;,;;(default);;Top;;Presentation - 2 Borders;;.;;(default);;Right;;Presentation - 2 Borders;;/;;(default);;Bottom;;Presentation - 2 Borders;;/;;(default);;Middle;;Presentation - 2 Borders;;-;;(default);;Left;;Presentation - 3 Borders;;,;;(default);;Top;;Presentation - 3 Borders;;.;;(default);;Right;;Presentation - 3 Borders;;/;;(default);;Bottom;;Presentation - 3 Borders;;/;;(default);;Middle;;Presentation - 3 Borders;;-;;(default);;Left;;Presentation - 4 Borders;;,;;(default);;Top;;Presentation - 4 Borders;;.;;(default);;Right;;Presentation - 4 Borders;;/;;(default);;Bottom;;Presentation - 4 Borders;;/;;(default);;Middle;;Presentation - 4 Borders;;.;;(default);;Left;;Presentation - With Chart;;-;;(default);;Top;;Presentation - With Chart;;/;;(default);;Right;;Presentation - With Chart;;0;;(default);;Bottom;;Presentation - With Chart;;0;;(default);;Middle;;Presentation - With Chart;;,;;(default);;Left;;Detail Text/Large Chart;;+;;(default);;Top;;Detail Text/Large Chart;;-;;(default);;Right;;Detail Text/Large Chart;;.;;(default);;Bottom;;Detail Text/Large Chart;;.;;(default);;Middle;;Detail Text/Large Chart;;4;;(default);;Left;;Detail - Arrow Title Navigation;;3;;(default);;Top;;Detail - Arrow Title Navigation;;5;;(default);;Right;;Detail - Arrow Title Navigation;;6;;(default);;Bottom;;Detail - Arrow Title Navigation;;6;;(default);;Middle;;Detail - Arrow Title Navigation;;ʺ locgsnfgnofgzisgmswmoswm7xswmnlocgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm-xswmZlocgzisgmswm#oswmFxswmpsappsbpPlocgsnfgzisgmswmoswm2xswmdpsapP locgsnfgzisgmswmoswm2xswmd locgzisgmswmoswm2xswmdpsaplocgzisgmswmoswm2xswmdpsappsbp locgzisg ibll@ mswmoswm(xswmPpsappsbpPlocgzisgmswmoswm2xswmdpsappsbp locgzisg mswmoswm(xswmPpsaplocgzisgmswmoswm2xswmdpsaplocgsnfgzisgmswmoswm2xswmdlocg33fsnfgzisgmswmoswm2xswmdlocg33fsnfgzisgmswmoswm2xswmd locgsnfgzisgmswmoswm2xswmd!locgzisgmswmoswm2xswmd" locg33fsnfgzisgmswmoswm2xswmd#!locgsnfgzisgmswmoswm2xswmd$"locg33fsnfgzisgmswmoswm2xswmd%#locgsnfgzisgmswmoswm2xswmd&$locgzisgmswmoswm2xswmd'%locgsnfgzisgmswmoswm2xswmd(&locg33fsnfgzisgmswmoswm2xswmd)'locgsnfgzisgmswmoswm2xswmd*(locg33fsnfgzisgmswmoswm2xswmd+)locg33fzisgmswm#oswmFxswm,*locgsnfgzisgmswmoswm2xswmdpsappsbp -+ locgsnfgzisgibll@ mswmoswm2xswmdpsappsbpP.,locgzisgmswmoswm2xswmdpsappsbp /-locgzisg mswmoswm(xswmPpsap0. locgsnfgzisghibllmswm-oswmZxswmpsapmfbppsbpxiubphlubpmunp1/locgzisgmswmoswm2xswmd20locgzisg ibll@ mswmoswm(xswmPpsappsbp(31locgzisgmswmoswm2xswmd42locgzisgmswmoswm2xswmdpsap5364758697:8;9locgzisgmswmoswm2xswmdpsappsbp <:locgzisgibll@ mswmoswm2xswmdpsappsbpP=;locgzisgmswmoswm2xswmdpsappsbp ><locgzisg mswmoswm(xswmPpsap?=locgzisgmswmoswm2xswmdpsap@locgfsnfgzisgmswm2oswmxxswmpsappsbpxA locgzisgmswmoswm2xswmdpsappsbpxB locgsnfgzisg mswmoswm(xswmPpsapC locgzisgmswmoswm2xswmdpsappsbpxD locgzisg mswmoswm(xswmPpsapElocgzisgmswmoswm2xswmdpsapFlocgzisgmswmoswm2xswmdpsappsbpxGlocgsnfgzisg mswmoswm(xswmPpsapHlocgzisgmswmoswm2xswmdpsappsbpxIlocgzisg mswmoswm(xswmPpsapJlocgzisgmswmoswm2xswmdpsapKlocgzisgmswmoswm2xswmdpsappsbpxLlocgsnfgzisg mswmoswm(xswmPpsapM>locgzisgmswmoswm2xswmdpsappsbpxN?locgzisg mswmoswm(xswmPpsapO@locgzisgmswmoswm2xswmdpsapPAlocgfsnfgzisgmswm#oswmFxswmpsappsbpxRClocgsnfgzisghmswm-oswmZxswmpsappsbp SD locgsnfgzisgibllmswmoswm2xswmdpsapmfbppsbpPiubphlubpmunpTElocgzisgmswmoswm2xswmdpsappsbp UFlocgzisg ibll@ mswmoswm(xswmPpsappsbpPVGlocgzisgmswmoswm2xswmdpsappsbp WHlocgzisg mswmoswm(xswmPpsapXIlocgzisgmswmoswm2xswmdpsapYJlocgzisgmswmoswm2xswmdpsappsbp ZKlocgzisg ibll@ mswmoswm(xswmPpsappsbpP[Llocgzisgmswmoswm2xswmdpsappsbp \Mlocgzisg mswmoswm(xswmPpsap]Nlocgzisgmswmoswm2xswmdpsap^Olocgzisgmswmoswm2xswmdpsappsbp _Plocgzisg ibll@ mswmoswm(xswmPpsappsbpP`Qlocgzisgmswmoswm2xswmdpsappsbp aRlocgzisg mswmoswm(xswmPpsapbSlocgzisgmswmoswm2xswmdpsapcTlocgzisgmswmoswm2xswmdpsappsbp dUlocgzisg ibll@ mswmoswm(xswmPpsappsbpPeVlocgzisgmswmoswm2xswmdpsappsbp fWlocgzisg mswmoswm(xswmPpsapgXlocgzisgmswmoswm2xswmdpsaphY locgzisgmswm#oswmFxswmpsapmfbppsbp iubphlubpwiZlocgzisgmswmoswm2xswmdpsappsbpxj[locgsnfgzisg mswmoswm(xswmPpsapk\locgzisgmswmoswm2xswmdpsappsbpxl]locgzisg mswmoswm(xswmPpsapm^locgzisgmswmoswm2xswmdpsapn_locgzisgmswmoswm2xswmdpsappsbpxo`locgsnfgzisg mswmoswm(xswmPpsappalocgzisgmswmoswm2xswmdpsappsbpxqblocgzisg mswmoswm(xswmPpsaprclocgzisgmswmoswm2xswmdpsapsdlocgzisgmswmoswm2xswmdpsappsbpxtelocgsnfgzisg mswmoswm(xswmPpsapuflocgzisgmswmoswm2xswmdpsappsbpxvglocgzisg mswmoswm(xswmPpsapwhlocgzisgmswmoswm2xswmdpsapxilocgzisgmswmoswm2xswmdpsappsbpxyjlocgsnfgzisg mswmoswm(xswmPpsapzklocgzisgmswmoswm2xswmdpsappsbpx{llocgzisg mswmoswm(xswmPpsap|mlocgzisgmswmoswm2xswmdpsap}n~opqrstuvwxyz{|}~locgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmAoswmxswmlocg33fsnfgzisgmswmoswm2/ ­xswmdlocg33fsnfgzisgmswmoswm2xswmd acaghsbglocgsnfgnofgacsgzisgnalhnrkmoslmmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmAoswmxswmlocg33fsnfgzisgmswmoswm2xswmdlocg33fsnfgzisgmswmoswm2xswmd acaghsbglocgsnfgnofgacsgzisgnalhnrkmoslmmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmAoswmxswmlocg33fsnfgzisgmswmoswm2xswmdlocg33fsnfgzisgmswmoswm2xswmd acaghsbglocgsnfgnofgacsgzisgnalhnrkmoslmmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm2xswmd locgsnfgnofgzisgmswmAoswmxswmlocg33fsnfgzisgmswmoswm2xswmdlocg33fsnfgzisgmswmoswm2xswmd acaghsbglocgsnfgnofgacsgzisgnalhnrkmoslmmswmoswm2xswmdlocgsnfgnofgzisgmswmoswm2xswmdlocgsnfgnofgzisgmswmAoswmxswmlocg33fsnfgzisgmswmoswm2xswmdlocg33fsnfgzisgmswmoswm2xswmd acaghsbglocgsnfgnofgacsgzisgnalhnrkmoslmmswmoswm2xswmd­ locg33fsnfgnofgzisgmswm#oswmFxswmlocgsnfgnofgzisgmswmUoswmxswmTlocg33fsnfgzisgmswm#oswmFxswmlocg33fsnfgzisgmswmoswm? @ABCDEFGHIJ !"#$%&'()*+,-./0123456789:;<=KLMNPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ­ҰrSNdX؂P "ȕ B-QbL(P @DidFXp b=(t@9P  ȑ@1D l`bCd P@;9AaY'\ hV,"` BOE  2ذ BtaBsn牉 K8|ra EthSL98E)PȬB-(VA&P!CâE(q9$(AHHSrd*P >=PJUpG7R ,@@(aV( &-` !8  KXA `P N`  L Jm(1D2p;̗C K 2`5@0P  H @ذ9R06QX1Q( =10'CX  CYS@  @eP> #N t= #p) Px: (r ! , $/--Q3 =BL=9UL@D J­M> 3U1K7$-*1**++ ˏQI؏TጯFQ)9 #33^0`&At%p.­p$GE˲IF1Z1(0­08:FQht0$AHlY0c Hn0!A0) J:ta=& ѣJ|hP =dS :D0 D@<(ف4r`#*aFGKdy٨8. GYSPBL! N P(04*bT0:`ģ)#8 e豀BbD@ǁXNp JD V08M` /CWC, q AlL`@!ԗ/A  X+dD]­ Pуa1HO #d= !=D<&`,$)eB:)`p  jZG 8 AE|PP!%d@)" Ldx"H"EstWq#@S--Ë \U@1 4A:p2 7$F $Xp 0! , !/Q1R#.LDUSRJ:% K1D=JHN0#-&82 U&L =@1%,66 Ì0&LO:("3E/1V0!& d(pDBP0cCm<I `' `2`!J =f`bC  |c,JPh* : e Q:q`Bx"" `Rpъ=HPe,<|H  mF)­H`@F%Axp #D#1!VH<) Q=*PP@EtN HJ@aQ'V|T$ʂU-N4eILHSYT`h ߗ?@ĄC'O|{Y%՜8q!E6o t@ }%|iI MtpA ``rWTPD+0j(q%KP@B%@$U 'e0Œ@[bNpcT(us E̥CS Ch 2HW8 $A HĔ Ă$pЁ@B L6 ! , ",0$)0SH I,++T=$' <L  6N(J:7 &6FJBA   H.@>JM/+,=LӄN)> GN/I&JK:E 9 @ 5ѐ v$Ij  y ` "F` c i2I&3"$hpƄU  jBE VT$1Ӌ h 2G%GRD#G2^I.PG J5=SɎLAK=L1**-J:&P$#=@I:ORL VPȌhX9h `1߄rbQ!  Xjr`)T  a%F9 BQ93A0D MYA(lXY!J870Y2E%?pt*BHCƀ U@ɍ RL+ GpG 0DBBNf@x ۊz8@N$x ϔΧqsdBN0A!p) hDpP8`{GN\pB!RXP9A/l0 !T !2L7JE!6P!J `0J$x4x<I=D1J)7( @# &Y0A(lJ$I! 0Chx!0`&&MAڝ ė|RZ Eh!LA/,:J$jM,GڹhrPQ(* #p(! ,#--+TA @I&U :1 SI NG=JO$<L1/ RH+*+ŌT= 80ЅSJJ9V#܄0;U 7 1+2IPpC:`MpP]Q@ 4Ag)FT @` z$  gbF( %Н I#$L!Qz *6­GUSآ;LQ+i(Æ 5b dJrbACRɢ$j6c4 (PEi$ 0Q`J 00m#` 'AR $J(a` LI N:Ii QC-P HTGN*(=a*%<Ek )2B-,(/`'Ѓ Ȣ 7NTQ` (PnIUE@9'dAKH s =@ 00Н (#!+\^@@3pd!W=9H D`"@0ᖂ<1%YU`6:\Q`A g 2_A5L .Z$`@P`&%! ,-*+R/U EI1?3REF=6U-00**$3H-MHL= ͸Y; =,L  $U >3CI%J JHpI0$B$V28qFxpHJnHB58HI)$FH #IT\!1  3@bUA 0KE &P@8 '. A1E"(`(dЉQ!B Qpc %6  N 0 : pj IhF 6!A*h    d0 Y7AɁ;%ңWQ<s9QJׄ"ALII0m­P@2L f|@>H dB+0t. (0?谁`Z@Pp0HOB $  Jf, B|9H F0ݗ1tPVfP#-T *0:Dkh74 0,w~ A~l! ,"+R+1SL =M=) Z  K%@FB$// :J"-M,@M+3VŊK-N+*#' EEޗ'1H%0 >L T$a! ʥJHQ8B?N&8F(J L1d 1c)%'(#' PQ :D8D&":TDňd( B:t!Ŗ*P  l(*b;XpVi5@Ʌ01 JB%e68p RA..VF/ 7qBQxU (Ɖ .C v`&Hp>_j ,L  iMA UNH!Db|ZNhKNϚj+H)A*0@i Nd+Ts UCtFD tm..>r5<(=B_P K$#'80ϔ&`PXA (MNIQ X"A)USH`@XbF 0dp P 0 8! ,%*O./F J0T <&1'$T H$TN-L=Q)6:JLJ@UJ76$13 L1++MH­K$ 'Q :CT)% '/,5Q?]MIAPLXh T'DĊzA0!  d MIoJd``P@$D ʾD倄"=8TI@U & Q=|sPeP2 z( m3(HX20pb!&$qKX\%PM!@ 6L \"uՔ*{!AB5Fds+8 ep׋  ؞1!HEe!ZjHȊJHp".iۖr$,b=I%AQҎrubBID( O\@RI0 TRC r U( A T0G @D'Iܐ3(l( B街Ilo1 | CFi (dXWf!H\9`y[. &I'v_PY Bm :(7[y=)>JLB dF"fȦ! , ,2FHGFFGIJLGHIIKRTSKIIR[kTXRXX[^ijjih^^WLLhknRjnnmkεhWTTJKHS^m[KS^[X SRRKGKLX]Guɕ۸^f۹eC­xeGZnP`9178U[X+ 9}߬vLҜ } GJZpV .UU,4lz)Ӛ-\W<PQ D!EU5IA%V&,s`,?84H"8VJSPWL!K%Tug,Cڸj`#,Wd r)­S })l Uqm߄hnAY2E[QF`MD*!Q1K FDL- hl'0"F-ص|Qqm ! | ǖrSCLԢu( @*t( P»B#/!Ho һw0 Ϫ0 >;&T|)h,/x1,)(lr)(2$-l !̈(`3#( ;/3 ,t ! ,12FHGFFGIJLGHIIKRTSKIFJR[kTXRYX[^ijjih^^WLKJjnnmlkkhXYWTTÔJIS^[XڡSRRKJQW$|K*d$IO%FF2dcG)G,) -(ݺ}YFDnYT) V,YBs'­ HޤrБ-E5PX*ݢEJlKlUJEZf&9$ͳFCjV_et)`YJ%L  ­쮪w aȁse%)[Դ29elC$sN [БlYg_5ÃddmȰ&b8LP{;rM=3@aw\u梺o  & 0bgZFcP8d1 t=V4 kC3)3Bbhhi[hd1˪ǍF.ȷX%3Z hxyjSgVu˓DJ8:YXES_,3a  _o7_VN3~HD!J,qqь(`vb0 'Q0цx!9S(q#(118GYH.j^,WDAP!LQ%k]X,SUL@RxaWeeeNM@=m̃P6@@QPGWekhERvD'JJL1Ul,NDp SB"ߤUG @+LD?$UxĦoz ^J@! '­ CQZuhLG P”1qO',Q՗Q,jW6$@#9a'R=lI< BKȳ H m [.K ,`#  &  8,p ;\q1do(tqaw\u梺o  & 0bgZFcP8d1 t=V4 kC3)3Bbhhi[hd1˪ǍF.ȷX%3Z hxyjSgVu˓DJ8:YXES_,3a$e543H_f!WLD$H((ZV]M)q# Tj`x",WDA6GT_-t5a9L16X0^@՘lFU.IT eS(#X* M<$(1ETV.Y8 0RG9usJRWlqq!)qTgGEN !驨 ml$%QG*G8#|(-l벒ÆL\F:h`q  Txp!,PqnuF[| ,/Tq.tW9oQ#nոI1,- &Yx'(/h+ BLj&I3 >3ZDjAJx 4­W (е`0v_—! ,32FHGFFGIJLHIIKRTSKIJR[kTXRYX[^ijjih^^WLKJjnnmlkkhXYWTTJIS^[X SRRKJQWIAR ɽ%2aw"NR$#.‘CʕyxN,"I;f,*M,^^tSУ@mRAY^Bz+hԫBn2m)$%j;6Tf-3HW4;34bU&H >aw\u梺o  & 0bgZFcP8d1 t=V4 kC3)3Bbhhi[hd1˪ǍF.ȷX%3Z hxyjSgVu˓DJ8:YXES_,3a$e543H_f!WLD$H((ZV]M)q# Tj`x",WDA6GT_-t5a9L16X0^@՘lFU.IT eS(#X* M<e!01ETV.Y8 0lю~ݜ[! gSXF*)FP@*,Z$^pH*wāF$%xxA꬐A:QB+­&!H!@ SƯᅰ.k̒,8@~)f+ KQah.eT+)h,Ⱥt[-)Bp kj.qxѰ šDf! |Cq!G-b8I %pGxFxI&,ͮ!#ACD{JA(lJ\  ЂFkr Q%f%! ,32FHGFFGIJLHIIKRTSKIJR[kTXRYX[^ijjih^^WLKJjnnmlkkhXYWTTJIS^[X SRRKJQWIAR ɽ%2aw"NR$#.‘CʕyxN,"I;f,*M,^^tSУ@mRAY^Bz+hԫBn2m)$%j;6Tf-3HW4;34bU&H >aw\u梺o  & 0bgZFcP8d1 t=V4 kC3)3Bbhhi[hd1˪ǍF.ȷX%3Z hxyjSgVu˓DJ8:YXES_,3a$e543H_f!WLD$H((ZV]M)q# Tj`x",WDA6GT_-t5a9L16X0^@՘lFU.IT eS(#X* M<e!01ETV.Y8 0lю~ݜ[! gSXF*)FP@*,Z$^pH*wāF$%xxA꬐A:QB+­&!H!@ SƯᅰ.k̒,8@~)f+ KQah.eT+)h,Ⱥt[-)Bp kj.qxѰ šDf! |Cq!G-b8I %pGxFxI&,ͮ!#ACD{JA(lJ\  ЂFkr Q%f%! ,32FHGFFGIJLHIIKRTSKIJR[kTXRYX[^ijjih^^WLKJjnnmlkkhXYWTTJIS^[X SRRKJQWIAR ɽ%2aw"NR$#.‘CʕyxN,"I;f,*M,^^tSУ@mRAY^Bz+hԫBn2m)$%j;6Tf-3HW4;34bU&H >aw\u梺o  & 0bgZFcP8d1 t=V4 kC3)3Bbhhi[hd1˪ǍF.ȷX%3Z hxyjSgVu˓DJ8:YXES_,3a$e543H_f!WLD$H((ZV]M)q# Tj`x",WDA6GT_-t5a9L16X0^@՘lFU.IT eS(#X* M<$(1ETV.Y8 0RG9usJRWlqq!)qTFG1P@*0^↤*p[" gXF1𥣴1JF4_2q6k ō _Rᅶas8@Bil" 0@DR!ta*j\ @—KF9oT&ŰD$ ff 8d0 I\pD&06 ,p N0 e(h\ -(]0K` 8c3 Ђ_٢ _! ,42FHGFFGIJLGHIIKRTSKIFJR[kTXRYX[^ijjih^^WLKJjnnmlkkhXYWTTÃJIS^[XڡSRRKJQW (0$(\ȄIw8ş6K(l0G)Vǯ$,XR1ZR;v4.ݬTX|y PZB IE#[|EjS]EKغEl4T­"_Zn]પW 2@e\Bt5j߿4hLpĊ1F7k!y@ᐡGÃ0Ż7Zf~x  vԴ Iⳍ9Cbm!G͔a3.Wha(2sԂH|j0\΢QV­--O~r)Ԣ4REoXVVSS, HvbqJ\dUVTG8""T)rEuw]nx,S hERvD'JJL1Ul,NDp SB"ߤUG @+LD?$UxĦoz ^J@! '­ CQZuhLG P”1qO',Q՗Q,jW6$@#9a'R=lI< BKȳ H m [.K ,`#  &  8,p ;\q1do(tqaw\u梺o  & 0bgZFcP8d1 t=V4 kC3)3Bbhhi[hd1˪ǍF.ȷX%3Z hxyjSgVu˓DJ8:YXES_,3a  _o7_VN3~HD!J,qqь(`vb0 'Q0цx!9S(q#(118GYH.j^,WDAP!LQ%k]X,SUL@RxaWeeeNM@=m̃P6@@QPGWekGuɕ۸^f۹eC­xeGj :ڐaPXPWmoZ6Ʒ! 1_id14%­kES4gC]| GJZp .UEWP EULk̲b\+CE1qT!{+WhP$F(X`Ei ^c[N>YNQC]1,!If8G8Rg"j+ѥ\a%hQ|N1J0L:(W~F!la^JHodmEFMg\V4aD,~1D23$E*REjG @+0[M 1QTن[<B@! t0 , B K  0 Q03[$d,&x1 2 ,p 'r1|i(,s)|s) ΐ` , ЂG'Ӌ  ! , ,2FHGFFGIJLGHIIKRTSKIJR[kTXRYX[^ijjih^^WLLhkrRjnnmlkkhXYWTTJKHS^m[KS^[X SRRKGK1 x[P ATgŸ%)E8oa (ƓI$Tcȑcr%呷8s.SfvƢHѓWz ʫSjA8:z4]Xfm KK5d ZB䫑#Lyڴ^;,Sƕ;w AC߿ &<jbe0CM;w 4Z AX2hTz 7@!ϚoS%qga@2qqdk0\ƢQ?Ik'~FDzf'erK̢4\ Fl4 N[ xAtJ [%X!G82@vxŁrE-ӆ)fg{2((@Pi8L)8ޒ!EJ$A?E$VPc)RP0MQC1[VV4q$%$``rQ貅u&+5fHq !,U B."騃<jj: Hj,ЀF + @¯k2p@ Ȳ,6ô<µBB  ­0 -.ț();Contents Contents